The domain within your query sequence starts at position 651 and ends at position 689; the E-value for the UBA domain shown below is 1.25e-6.

DESSVMQLAEMGFPLEACRKAVYFTGNTGAEVAFNWIIV

UBA

Ubiquitin associated domain

• SMART accession number: SM00165
• Description: Present in Rad23, SNF1-like kinases. The newly-found UBA in p62 is known to bind ubiquitin.
• Interpro abstract (IPR015940):

  UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [ (PUBMED:8871400) ]. The human homologue of yeast Rad23A is one example of a nucleotide excision-repair protein that contains both an internal and a C-terminal UBA domain. The solution structure of human Rad23A UBA(2) showed that the domain forms a compact three-helix bundle [ (PUBMED:9846873) ]. Comparison of the structures of UBA(1) and UBA(2) reveals that both form very similar folds and have a conserved large hydrophobic surface patch which may be a common protein-interacting surface present in diverse UBA domains. Evidence that ubiquitin binds to UBA domains leads to the prediction that the hydrophobic surface patch of UBA domains interacts with the hydrophobic surface on the five-stranded beta-sheet of ubiquitin [ (PUBMED:12079361) ].

  This domain is similar in sequence to the N-terminal domain of translation elongation factor EF1B (or EF-Ts) from bacteria, mitochondria and chloroplasts [ (PUBMED:8596629) ].

There are 32685 UBA domains in 26641 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Binding / catalysis: protein-binding, ubiquitin-binding

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Dieckmann T, Withers-Ward ES, Jarosinski MA, Liu CF, Chen IS, Feigon J
• Structure of a human DNA repair protein UBA domain that interacts with HIV-1 Vpr.
• Nat Struct Biol. 1998; 5: 1042-7

The HIV-1 protein Vpr is critical for a number of viral functions including a unique ability to arrest T-cells at a G2/M checkpoint and induce subsequent apoptosis. It has been shown to interact specifically with the second UBA (ubiquitin associated) domain found in the DNA repair protein HHR23A, a highly evolutionarily conserved protein. This domain is a commonly occurring sequence motif in some members of the ubiquitination pathway, UV excision repair proteins, and certain protein kinases. The three dimensional structure of the UBA domain, determined by NMR spectroscopy, is presented. The protein domain forms a compact three-helix bundle. One side of the protein has a hydrophobic surface that is the most likely Vpr target site.

• Grishin NV
• The R3H motif: a domain that binds single-stranded nucleic acids.
• Trends Biochem Sci. 1998; 23: 329-30

• Schultz J, Milpetz F, Bork P, Ponting CP
• SMART, a simple modular architecture research tool: identification of signaling domains.
• Proc Natl Acad Sci U S A. 1998; 95: 5857-64

Accurate multiple alignments of 86 domains that occur in signaling proteins have been constructed and used to provide a Web-based tool (SMART: simple modular architecture research tool) that allows rapid identification and annotation of signaling domain sequences. The majority of signaling proteins are multidomain in character with a considerable variety of domain combinations known. Comparison with established databases showed that 25% of our domain set could not be deduced from SwissProt and 41% could not be annotated by Pfam. SMART is able to determine the modular architectures of single sequences or genomes; application to the entire yeast genome revealed that at least 6.7% of its genes contain one or more signaling domains, approximately 350 greater than previously annotated. The process of constructing SMART predicted (i) novel domain homologues in unexpected locations such as band 4.1-homologous domains in focal adhesion kinases; (ii) previously unknown domain families, including a citron-homology domain; (iii) putative functions of domain families after identification of additional family members, for example, a ubiquitin-binding role for ubiquitin-associated domains (UBA); (iv) cellular roles for proteins, such predicted DEATH domains in netrin receptors further implicating these molecules in axonal guidance; (v) signaling domains in known disease genes such as SPRY domains in both marenostrin/pyrin and Midline 1; (vi) domains in unexpected phylogenetic contexts such as diacylglycerol kinase homologues in yeast and bacteria; and (vii) likely protein misclassifications exemplified by a predicted pleckstrin homology domain in a Candida albicans protein, previously described as an integrin.

• Hofmann K, Bucher P
• The UBA domain: a sequence motif present in multiple enzyme classes of the ubiquitination pathway.
• Trends Biochem Sci. 1996; 21: 172-3

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
22.35	map04120	Ubiquitin mediated proteolysis
12.94	map04012	ErbB signaling pathway
12.94	map04660	T cell receptor signaling pathway
12.94	map04630	Jak-STAT signaling pathway
12.94	map05220	Chronic myeloid leukemia
12.94	map04910	Insulin signaling pathway
9.41	map05040	Huntington's disease
1.18	map00562	Inositol phosphate metabolism
1.18	map00632	Benzoate degradation via CoA ligation
1.18	map03030	DNA replication

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with UBA domain which could be assigned to a KEGG orthologous group, and not all proteins containing UBA domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of UBA domains in PDB

PDB code	Title
1dv0	Refined NMR solution structure of the C-terminal UBA domain of the human homologue of RAD23A (HHR23A)
1f4i	SOLUTION STRUCTURE OF THE HHR23A UBA(2) MUTANT P333E, DEFICIENT IN BINDING THE HIV-1 ACCESSORY PROTEIN VPR
1ify	Solution Structure of the Internal UBA Domain of HHR23A
1oqy	Structure of the DNA repair protein hHR23a
1q02	NMR structure of the UBA domain of p62 (SQSTM1)
1qze	HHR23a protein structure based on residual dipolar coupling data
1veg	Solution Structure of RSGI RUH-012, a UBA Domain from Mouse cDNA
1vej	Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
1vek	Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA
1vg5	Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis cDNA
1whc	Solution Structure of RSGI RUH-027, a UBA domain from Mouse cDNA
1wiv	solution structure of RSGI RUH-023, a UBA domain from Arabidopsis cDNA
1wj7	Solution structure of RSGI RUH-015, a UBA domain from mouse cDNA
1wji	Solution Structure of the UBA Domain of Human Tudor Domain Containing Protein 3
1wr1	The complex sturcture of Dsk2p UBA with ubiquitin
1y8g	Catalytic and ubiqutin-associated domains of MARK2/PAR-1: Inactive double mutant with selenomethionine
1yla	Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
1z96	Crystal structure of the Mud1 UBA domain
1zmu	Catalytic and ubiqutin-associated domains of MARK2/PAR-1: Wild type
1zmv	Catalytic and ubiqutin-associated domains of MARK2/PAR-1: K82R mutant
1zmw	Catalytic and ubiqutin-associated domains of MARK2/PAR-1: T208A/S212A inactive double mutant
2bwb	Crystal structure of the UBA domain of Dsk2 from S. cerevisiae
2bwe	The crystal structure of the complex between the UBA and UBL domains of Dsk2
2cpw	Solution structure of RSGI RUH-031, a UBA domain from human cDNA
2cwb	Solution Structure of the Ubiquitin-Associated Domain of Human BMSC-UbP and its Complex with Ubiquitin
2d9s	Solution structure of RSGI RUH-049, a UBA domain from mouse cDNA
2dag	Solution Structure of the First UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
2dah	Solution Structure of the C-terminal UBA Domain in the Human Ubiquilin 3
2dai	Solution Structure of the First UBA Domain in the Human Ubiquitin Associated Domain Containing 1 (UBADC1)
2dak	Solution Structure of the Second UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
2den	Solution Structure of the Ubiquitin-Associated Domain of Human BMSC-UbP and its Complex with Ubiquitin
2dkl	Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)
2do6	Solution structure of RSGI RUH-065, a UBA domain from human cDNA
2ekk	Solution structure of RUH-074, a human UBA domain
2g3q	Solution Structure of Ede1 UBA-ubiquitin complex
2hak	Catalytic and ubiqutin-associated domains of MARK1/PAR-1
2jnh	Solution Structure of the UBA Domain from Cbl-b
2juj	Solution Structure of the UBA domain from c-Cbl
2jy5	NMR structure of Ubiquilin 1 UBA domain
2jy6	Solution structure of the complex of ubiquitin and ubiquilin 1 UBA domain
2jy7	NMR structure of the ubiquitin associated (UBA) domain of p62 (SQSTM1). RDC refined
2jy8	NMR structure of the ubiquitin associated (UBA) domain of p62 (SQSTM1) in complex with ubiquitin. RDC refined
2k0b	NMR structure of the UBA domain of p62 (SQSTM1)
2knv	NMR dimer structure of the UBA domain of p62 (SQSTM1)
2knz	NMR structure of CIP75 UBA domain
2lbc	solution structure of tandem UBA of USP13
2mr9	2MR9
2mro	2MRO
2o25	Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9
2oo9	crystal structure of the UBA domain from human c-Cbl ubiquitin ligase
2ooa	crystal structure of the UBA domain from Cbl-b ubiquitin ligase
2oob	crystal structure of the UBA domain from Cbl-b ubiquitin ligase in complex with ubiquitin
2pwq	Crystal structure of a putative ubiquitin conjugating enzyme from Plasmodium yoelii
2qnj	Kinase and Ubiquitin-associated domains of MARK3/Par-1
2qsf	Crystal structure of the Rad4-Rad23 complex
2qsg	Crystal structure of Rad4-Rad23 bound to a UV-damaged DNA
2qsh	Crystal structure of Rad4-Rad23 bound to a mismatch DNA
2r0i	Crystal structure of a kinase MARK2/Par-1 mutant
2rru	Solution structure of the UBA omain of p62 and its interaction with ubiquitin
2wzj	Catalytic and UBA domain of kinase MARK2/(Par-1) K82R, T208E double mutant
3b0f	Crystal structure of the UBA domain of p62 and its interaction with ubiquitin
3e46	Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington interacting protein 2) M172A mutant
3f92	Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington Interacting Protein 2) M172A mutant crystallized at pH 8.5
3fe3	Crystal structure of the kinase MARK3/Par-1: T211A-S215A double mutant
3iec	Helicobacter pylori CagA Inhibits PAR1/MARK Family Kinases by Mimicking Host Substrates
3ihp	Covalent Ubiquitin-Usp5 Complex
3k9o	The crystal structure of E2-25K and UBB+1 complex
3k9p	The crystal structure of E2-25K and ubiquitin complex
4un2	4UN2
4yir	4YIR
5dfl	5DFL
5eak	5EAK
5es1	5ES1

Links (links to other resources describing this domain)

• INTERPRO: IPR015940
• PFAM: UBA