The domain within your query sequence starts at position 18 and ends at position 89; the E-value for the UBQ domain shown below is 1.07e-13.

INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLE
MEDEDTIDVFQQ

UBQ

Ubiquitin homologues

• SMART accession number: SM00213
• Description: Ubiquitin-mediated proteolysis is involved in the regulated turnover of proteins required for controlling cell cycle progression
• Interpro abstract (IPR000626):

  Ubiquitin is a globular protein, the last four C-terminal residues (Leu-Arg-Gly-Gly) extending from the compact structure to form a 'tail', important for its function. The latter is mediated by the covalent conjugation of ubiquitin to target proteins, by an isopeptide linkage between the C-terminal glycine and the epsilon amino group of lysine residues in the target proteins.

  Ubiquitin is a protein of 76 amino acid residues, found in all eukaryotic cells and whose sequence is extremely well conserved from protozoan to vertebrates. Ubiquitin acts through its post-translational attachment (ubiquitinylation) to other proteins, where these modifications alter the function, location or trafficking of the protein, or targets it for destruction by the 26S proteasome [ (PUBMED:15454246) ].

  Ubiquitin is expressed as three different precursors: a polymeric head-to-tail concatemer of identical units (polyubiquitin), and two N-terminal ubiquitin moieties, UbL40 and UbS27, that are fused to the ribosomal polypeptides L40 and S27, respectively. Specific endopeptidases cleave these precursor molecules [ (PUBMED:15571815) ] to release ubiquitin moieties that are identical in sequence and contribute to the ubiquitin pool [ (PUBMED:16185873) ]. Some organisms express additional ubiquitin fusion proteins [ (PUBMED:12729753) ]. Furthermore, there are several ubiquitin-like proteins derived from ubiquitin [ (PUBMED:12826404) ].

  This entry represents a domain characteristic of ubiquitin (Ub) and ubiquitin-like (Ubl) proteins such as SUMO [ (PUBMED:17491593) (PUBMED:15479240) ] and Nedd8 [ (PUBMED:9857030) ].

• GO function: protein binding (GO:0005515)

There are 49174 UBQ domains in 38515 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Bedford MT, Leder P
• The FF domain: a novel motif that often accompanies WW domains.
• Trends Biochem Sci. 1999; 24: 264-5

• Hofmann K, Bucher P
• The PCI domain: a common theme in three multiprotein complexes.
• Trends Biochem Sci. 1998; 23: 204-5

• Haas AL
• Introduction: evolving roles for ubiquitin in cellular regulation.
• FASEB J. 1997; 11: 1053-4

• Haas AL, Siepmann TJ
• Pathways of ubiquitin conjugation.
• FASEB J. 1997; 11: 1257-68

The covalent attachment of the polypeptide ubiquitin to proteins marks them for degradation by the ubiquitin/26S proteasome-dependent degradation pathway. This pathway functions in regulating many fundamental processes required for cell viability. Phylogenetic analysis of ubiquitin sequences reveals greater variability among lower eukaryotes and defines essential residues, many of which are conserved among the three ubiquitin-like proteins known to undergo parallel ligation pathways. The hierarchical design of the ubiquitin conjugation mechanism provides great flexibility for the divergent evolution of new functions mediated by this posttranslational modification. Within this hierarchy, a single ubiquitin-activating enzyme provides charged intermediates to multiple targeting pathways defined by cognate ubiquitin carrier protein (E2)/ligase (E3) pairs. Sequence analysis of E2 isozymes shows that the E2 superfamily is composed of distinct function-specific families. The apparent lack of E2/E3 specificity suggested in the literature results from the presence of multiple isozymes within many E2 families and erroneous family assignments based on incomplete data sets. Other apparent inconsistencies are explained by interfamily sequence relationships among some E2 isoforms.

• Hershko A
• Roles of ubiquitin-mediated proteolysis in cell cycle control.
• Curr Opin Cell Biol. 1997; 9: 788-99

Selective degradation of cyclins, inhibitors of cyclin-dependent kinases and anaphase inhibitors is responsible for several major cell cycle transitions. The degradation of these cell cycle regulators is controlled by the action of ubiquitin-protein-ligase complexes, which target the regulators for degradation by the 26S proteasome. Recent results indicate that two types of multisubunit ubiquitin ligase complexes, which are connected to the protein kinase regulatory network of the cell cycle in different ways, are responsible for the specific and programmed degradation of many cell cycle regulators.

• Saitoh H, Pu RT, Dasso M
• SUMO-1: wrestling with a new ubiquitin-related modifier.
• Trends Biochem Sci. 1997; 22: 374-6

• Hochstrasser M
• Ubiquitin-dependent protein degradation.
• Annu Rev Genet. 1996; 30: 405-39

A growing number of cellular regulatory mechanisms are being linked to protein modification by the polypeptide ubiquitin. These include key transitions in the cell cycle, class I antigen processing, signal transduction pathways, and receptor-mediated endocytosis. In most, but not all, of these examples, ubiquitination of a protein leads to its degradation by the 26S proteasome. Following attachment of ubiquitin to a substrate and binding of the ubiquitinated protein to the proteasome, the bound substrate must be unfolded (and eventually deubiquitinated) and translocated through a narrow set of channels that leads to the proteasome interior, where the polypeptide is cleaved into short peptides. Protein ubiquitination and deubiquitination are both mediated by large enzyme families, and the proteasome itself comprises a family of related but functionally distinct particles. This diversity underlies both the high substrate specificity of the ubiquitin system and the variety of regulatory mechanisms that it serves.

• Hofmann K, Bucher P
• The UBA domain: a sequence motif present in multiple enzyme classes of the ubiquitination pathway.
• Trends Biochem Sci. 1996; 21: 172-3

• Isaksson A, Musti AM, Bohmann D
• Ubiquitin in signal transduction and cell transformation.
• Biochim Biophys Acta. 1996; 1288: 219-219

Since the discovery of ubiquitin-dependent protein degradation almost two decades ago, great strides have been made towards a detailed understanding of the biochemistry of this process (reviewed in [1-3]). It was, however, only in recent years that the physiological role of the ubiquitin system in signal transduction and the regulation of several cell functions started to be appreciated and experimentally addressed. As with other principal mechanisms of signal transduction, such as phosphorylation or GTP hydrolysis, much of the information regarding the role of the ubiquitin system as a component of cell regulation and signaling cascades, was gained in studies of transformation and the control of cell growth. It seems, however, that ubiquitin-dependent proteolysis, and possibly other processes that are controlled by protein ubiquitination, play a role in many aspects of cellular function from the control of differentiation to intracellular trafficking [1,3,4]. Here we will review some of the results that implicate ubiquitin-dependent proteolysis in the control of cell growth and that indicate how perturbations of ubiquitin-dependent degradation of oncogene and tumor suppressor gene products may contribute to cell transformation and oncogenesis.

• Watkins JF, Sung P, Prakash L, Prakash S
• The Saccharomyces cerevisiae DNA repair gene RAD23 encodes a nuclear protein containing a ubiquitin-like domain required for biological function.
• Mol Cell Biol. 1993; 13: 7757-65

In eukaryotes, the posttranslational conjugation of ubiquitin to various cellular proteins marks them for degradation. Interestingly, several proteins have been reported to contain ubiquitin-like (ub-like) domains that are in fact specified by the DNA coding sequences of the proteins. The biological role of the ub-like domain in these proteins is not known; however, it has been proposed that this domain functions as a degradation signal rendering the proteins unstable. Here, we report that the product of the Saccharomyces cerevisiae RAD23 gene, which is involved in excision repair of UV-damaged DNA, bears a ub-like domain at its amino terminus. This finding has presented an opportunity to define the functional significance of this domain. We show that deletion of the ub-like domain impairs the DNA repair function of RAD23 and that this domain can be functionally substituted by the authentic ubiquitin sequence. Surprisingly, RAD23 is highly stable, and the studies reported herein indicate that its ub-like domain does not mediate protein degradation. Thus, in RAD23 at least, the ub-like domain affects protein function in a nonproteolytic manner.

• Ozkaynak E, Finley D, Solomon MJ, Varshavsky A
• The yeast ubiquitin genes: a family of natural gene fusions.
• EMBO J. 1987; 6: 1429-39

Ubiquitin is a 76-residue protein highly conserved among eukaryotes. Conjugation of ubiquitin to intracellular proteins mediates their selective degradation in vivo. We describe a family of four ubiquitin-coding loci in the yeast Saccharomyces cerevisiae. UB11, UB12 and UB13 encode hybrid proteins in which ubiquitin is fused to unrelated ('tail') amino acid sequences. The ubiquitin coding elements of UB11 and UB12 are interrupted at identical positions by non-homologous introns. UB11 and UB12 encode identical 52-residue tails, whereas UB13 encodes a different 76-residue tail. The tail amino acid sequences are highly conserved between yeast and mammals. Each tail contains a putative metal-binding, nucleic acid-binding domain of the form Cys-X2-4-Cys-X2-15-Cys-X2-4-Cys, suggesting that these proteins may function by binding to DNA. The fourth gene, UB14, encodes a polyubiquitin precursor protein containing five ubiquitin repeats in a head-to-tail, spacerless arrangement. All four ubiquitin genes are expressed in exponentially growing cells, while in stationary-phase cells the expression of UB11 and UB12 is repressed. The UB14 gene, which is strongly inducible by starvation, high temperatures and other stresses, contains in its upstream region strong homologies to the consensus 'heat shock box' nucleotide sequence. Elsewhere we show that the essential function of the UB14 gene is to provide ubiquitin to cells under stress.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
45.36	map03010	Ribosome
13.40	map05020	Parkinson's disease
13.40	map04120	Ubiquitin mediated proteolysis
11.34	map03320	PPAR signaling pathway
6.19	map05211	Renal cell carcinoma
5.15	map00380	Tryptophan metabolism
2.06	map01040	Biosynthesis of unsaturated fatty acids
1.03	map03022	Basal transcription factors
1.03	map00632	Benzoate degradation via CoA ligation
1.03	map00903	Limonene and pinene degradation

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with UBQ domain which could be assigned to a KEGG orthologous group, and not all proteins containing UBQ domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of UBQ domains in PDB

PDB code	Title
1a5r	STRUCTURE DETERMINATION OF THE SMALL UBIQUITIN-RELATED MODIFIER SUMO-1, NMR, 10 STRUCTURES
1aar	STRUCTURE OF A DIUBIQUITIN CONJUGATE AND A MODEL FOR INTERACTION WITH UBIQUITIN CONJUGATING ENZYME (E2)
1bt0	STRUCTURE OF UBIQUITIN-LIKE PROTEIN, RUB1
1c3t	ROTAMER STRAIN AS A DETERMINANT OF PROTEIN STRUCTURAL SPECIFICITY
1cmx	STRUCTURAL BASIS FOR THE SPECIFICITY OF UBIQUITIN C-TERMINAL HYDROLASES
1d3z	UBIQUITIN NMR STRUCTURE
1euv	X-RAY STRUCTURE OF THE C-TERMINAL ULP1 PROTEASE DOMAIN IN COMPLEX WITH SMT3, THE YEAST ORTHOLOG OF SUMO.
1f9j	STRUCTURE OF A NEW CRYSTAL FORM OF TETRAUBIQUITIN
1fxt	STRUCTURE OF A CONJUGATING ENZYME-UBIQUITIN THIOLESTER COMPLEX
1g6j	STRUCTURE OF RECOMBINANT HUMAN UBIQUITIN IN AOT REVERSE MICELLES
1gjz	Solution structure of a dimeric N-terminal fragment of human ubiquitin
1iyf	Solution structure of ubiquitin-like domain of human parkin
1j8c	Solution Structure of the Ubiquitin-like Domain of hPLIC-2
1l2n	Smt3 Solution Structure
1lm8	Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex
1lqb	Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the pVHL/elongin-C/elongin-B complex
1m94	Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1
1mg8	NMR structure of ubiquitin-like domain in murine Parkin
1nbf	Crystal structure of a UBP-family deubiquitinating enzyme in isolation and in complex with ubiquitin aldehyde
1ndd	STRUCTURE OF NEDD8
1ogw	Synthetic Ubiquitin with fluoro-Leu at 50 and 67
1oqy	Structure of the DNA repair protein hHR23a
1otr	Solution Structure of a CUE-Ubiquitin Complex
1p1a	NMR structure of ubiquitin-like domain of hHR23B
1p3q	Mechanism of Ubiquitin Recognition by the CUE Domain of VPS9
1p98	High-resolution NMR structure of the Ubl-domain of HHR23A
1p9d	High-resolution structure of the complex of HHR23A ubiquitin-like domain and the C-terminal ubiquitin-interacting motif of proteasome subunit S5a
1q0w	Solution structure of Vps27 amino-terminal UIM-ubiquitin complex
1q5w	Ubiquitin Recognition by Npl4 Zinc-Fingers
1qze	HHR23a protein structure based on residual dipolar coupling data
1r4m	APPBP1-UBA3-NEDD8, an E1-ubiquitin-like protein complex
1r4n	APPBP1-UBA3-NEDD8, an E1-ubiquitin-like protein complex with ATP
1s1q	TSG101(UEV) domain in complex with Ubiquitin
1sif	Crystal structure of a multiple hydrophobic core mutant of ubiquitin
1tbe	STRUCTURE OF TETRAUBIQUITIN SHOWS HOW MULTIUBIQUITIN CHAINS CAN BE FORMED
1tgz	Structure of human Senp2 in complex with SUMO-1
1ttn	Solution structure of the ubiquitin-like domain of human DC-UBP from dendritic cells
1u4a	Solution structure of human SUMO-3 C47S
1ubi	SYNTHETIC STRUCTURAL AND BIOLOGICAL STUDIES OF THE UBIQUITIN SYSTEM. PART 1
1ubq	STRUCTURE OF UBIQUITIN REFINED AT 1.8 ANGSTROMS RESOLUTION
1ud7	SOLUTION STRUCTURE OF THE DESIGNED HYDROPHOBIC CORE MUTANT OF UBIQUITIN, 1D7
1uel	Solution structure of ubiquitin-like domain of hHR23B complexed with ubiquitin-interacting motif of proteasome subunit S5a
1uzx	A complex of the Vps23 UEV with ubiquitin
1v5o	Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 1700011N24Rik Protein
1v5t	Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 8430435I17Rik Protein
1v80	Solution structures of ubiquitin at 30 bar and 3 kbar
1v81	Solution structures of ubiquitin at 30 bar and 3 kbar
1v86	Solution structure of the ubiquitin domain from mouse D7Wsu128e protein
1vcb	THE VHL-ELONGINC-ELONGINB STRUCTURE
1we6	Solution structure of Ubiquitin-like domain in splicing factor AAL91182
1we7	Solution structure of Ubiquitin-like domain in SF3a120
1wgd	Solution structure of the Ubl-domain of Herp
1wgg	Solution Structure of the N-terminal Ubiquitin-like Domain of Mouse Ubiquitin Specific Protease 14 (USP14)
1wh3	Solution structure of C-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 OASL)
1wia	Solution structure of mouse hypothetical ubiquitin-like protein BAB25500
1wm2	Crystal structure of human SUMO-2 protein
1wm3	Crystal structure of human SUMO-2 protein
1wr1	The complex sturcture of Dsk2p UBA with ubiquitin
1wr6	Crystal structure of GGA3 GAT domain in complex with ubiquitin
1wrd	Crystal structure of Tom1 GAT domain in complex with ubiquitin
1wx7	Solution Structure of the N-terminal Ubiquitin-like Domain in the Human Ubiquilin 3 (UBQLN3)
1wx8	Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein
1wx9	Solution Structure of the N-terminal Ubiquitin-like Domain in the Human BAT3 Protein
1wxv	Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1
1wy8	Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF)
1wyw	Crystal Structure of SUMO1-conjugated thymine DNA glycosylase
1wz0	Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein
1x1m	Solution Structure of the N-terminal Ubiquitin-like Domain in Mouse Ubiquitin-like Protein SB132
1xd3	Crystal structure of UCHL3-UbVME complex
1xqq	Simultaneous determination of protein structure and dynamics
1xt9	Crystal Structure of Den1 in complex with Nedd8
1y8r	SUMO E1 ACTIVATING ENZYME SAE1-SAE2-SUMO1-MG-ATP COMPLEX
1yd8	COMPLEX OF HUMAN GGA3 GAT DOMAIN AND UBIQUITIN
1yiw	X-ray Crystal Structure of a Chemically Synthesized Ubiquitin
1yj1	X-ray Crystal Structure of a Chemically Synthesized [D-Gln35]Ubiquitin
1yqb	Human Ubiquilin 3
1yx5	Solution Structure of S5a UIM-1/Ubiquitin Complex
1yx6	Solution Structure of S5a UIM-2/Ubiquitin Complex
1z2m	Crystal Structure of ISG15, the Interferon-Induced Ubiquitin Cross Reactive Protein
1z5s	Crystal structure of a complex between UBC9, SUMO-1, RANGAP1 and NUP358/RANBP2
1zgu	Solution structure of the human Mms2-Ubiquitin complex
1zkh	Solution structure of a human ubiquitin-like domain in SF3A1
1zw7	Elimination of the C-cap in Ubiquitin Structure, Dynamics and Thermodynamic Consequences
2asq	Solution Structure of SUMO-1 in Complex with a SUMO-binding Motif (SBM)
2awt	Solution Structure of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (SUMO-2)
2ayo	Structure of USP14 bound to ubquitin aldehyde
2bf8	Crystal structure of SUMO modified ubiquitin conjugating enzyme E2- 25K
2bgf	NMR structure of Lys48-linked di-ubiquitin using chemical shift perturbation data together with RDCs and 15N-relaxation data
2bkr	NEDD8 NEDP1 complex
2bwe	The crystal structure of the complex between the UBA and UBL domains of Dsk2
2bwf	Crystal sturcture of the UBL domain of Dsk2 from S. cerevisiae
2c7m	human Rabex-5 residues 1-74 in complex with Ubiquitin
2c7n	Human Rabex-5 residues 1-74 in complex with Ubiquitin
2c9w	CRYSTAL STRUCTURE OF SOCS-2 IN COMPLEX WITH ELONGIN-B AND ELONGIN-C AT 1.9A RESOLUTION
2ckh	SENP1-SUMO2 complex
2d07	Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
2d3g	Double sided ubiquitin binding of Hrs-UIM
2den	Solution Structure of the Ubiquitin-Associated Domain of Human BMSC-UbP and its Complex with Ubiquitin
2dx5	The complex structure between the mouse EAP45-GLUE domain and ubiquitin
2dzi	2DZI/Solution Structure of the N-terminal Ubiquitin-like Domain in Human Ubiquitin-like Protein 4A (GDX)
2eke	Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
2faz	Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
2fcm	X-ray Crystal Structure of a Chemically Synthesized [D-Gln35]Ubiquitin with a Cubic Space Group
2fcn	X-ray Crystal Structure of a Chemically Synthesized [D-Val35]Ubiquitin with a Cubic Space Group
2fcq	X-ray Crystal Structure of a Chemically Synthesized Ubiquitin with a Cubic Space Group
2fcs	X-ray Crystal Structure of a Chemically Synthesized [L-Gln35]Ubiquitin with a Cubic Space Group
2fid	Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin
2fif	Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin
2fnj	Crystal structure of a B30.2/SPRY domain-containing protein GUSTAVUS in complex with Elongin B and Elongin C
2fuh	Solution Structure of the UbcH5c/Ub Non-covalent Complex
2g3q	Solution Structure of Ede1 UBA-ubiquitin complex
2g45	Co-crystal structure of znf ubp domain from the deubiquitinating enzyme isopeptidase T (isot) in complex with ubiquitin
2g4d	Crystal structure of human SENP1 mutant (C603S) in complex with SUMO-1
2gbj	Crystal Structure of the 9-10 8 Glycine Insertion Mutant of Ubiquitin.
2gbk	Crystal Structure of the 9-10 MoaD Insertion Mutant of Ubiquitin
2gbm	Crystal Structure of the 35-36 8 Glycine Insertion Mutant of Ubiquitin
2gbn	Crystal Structure of the 35-36 8 Glycine Insertion Mutant of Ubiquitin
2gbr	Crystal Structure of the 35-36 MoaD Insertion Mutant of Ubiquitin
2gmi	Mms2/Ubc13~Ubiquitin
2hd5	USP2 in complex with ubiquitin
2hj8	Solution NMR structure of the C-terminal domain of the interferon alpha-inducible ISG15 protein from Homo sapiens. Northeast Structural Genomics target HR2873B
2hth	Structural basis for ubiquitin recognition by the human EAP45/ESCRT-II GLUE domain
2ibi	Covalent Ubiquitin-USP2 Complex
2io0	Crystal structure of human Senp2 in complex with preSUMO-2
2io1	Crystal structure of human Senp2 in complex with preSUMO-3
2io2	Crystal structure of human Senp2 in complex with RanGAP1-SUMO-1
2io3	Crystal structure of human Senp2 in complex with RanGAP1-SUMO-2
2iy0	SENP1 (mutant) SUMO1 RanGAP
2iy1	SENP1 (mutant) full length SUMO1
2iyd	SENP1 covalent complex with SUMO-2
2izv	CRYSTAL STRUCTURE OF SOCS-4 IN COMPLEX WITH ELONGIN-B AND ELONGIN-C AT 2.55A RESOLUTION
2j7q	Crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein M48 in complex with a ubquitin-based suicide substrate
2jf5	crystal structure of Lys63-linked di-ubiquitin
2jri	Solution structure of the Josephin domain of Ataxin-3 in complex with ubiquitin molecule.
2jt4	Solution Structure of the Sla1 SH3-3-Ubiquitin Complex
2jvc	NMR solution structure of ubiquitin like protein
2jwz	Mutations in the hydrophobic core of ubiquitin differentially affect its recognition by receptor proteins
2jy6	Solution structure of the complex of ubiquitin and ubiquilin 1 UBA domain
2jz3	SOCS box elonginBC ternary complex
2jzz	Solid-State NMR Structure of Microcrystalline Ubiquitin
2k1f	SUMO-3 from Drosophila melanogaster (dsmt3)
2k25	Automated NMR Structure of the UBB by FAPSY
2k39	Recognition dynamics up to microseconds revealed from RDC derived ubiquitin ensemble in solution
2k6d	CIN85 Sh3-C domain in complex with ubiquitin
2k8b	Solution structure of PLAA family ubiquitin binding domain (PFUC) cis isomer in complex with ubiquitin
2k8c	Solution structure of PLAA family ubiquitin binding domain (PFUC) trans isomer in complex with ubiquitin
2k8h	Solution structure of SUMO from Trypanosoma brucei
2kan	Solution NMR structure of ubiquitin-like domain of Arabidopsis thaliana protein At2g32350. Northeast Structural Genomics Consortium target AR3433A
2kd0	NMR solution structure of O64736 protein from Arabidopsis thaliana. Northeast Structural Genomics Consortium MEGA Target AR3445A
2kde	NMR structure of major S5a (196-306):K48 linked diubiquitin species
2kdf	NMR structure of minor S5a (196-306):K48 linked diubiquitin species
2kdi	Solution structure of a Ubiquitin/UIM fusion protein
2khw	Solution Structure of the human Polymerase iota UBM2-Ubiquitin Complex
2kjh	NMR based structural model of the UBCH8-UBIQUITIN complex
2kk8	NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium target AR3449A
2klc	NMR solution structure of human ubiquitin-like domain of ubiquilin 1, Northeast Structural Genomics Consortium (NESG) target HT5A
2klg	PERE NMR structure of ubiquitin
2kn5	A Correspondence Between Solution-State Dynamics of an Individual Protein and the Sequence and Conformational Diversity of its Family
2knb	Solution NMR structure of the parkin Ubl domain in complex with the endophilin-A1 SH3 domain
2ko3	Nedd8 solution structure
2kox	NMR residual dipolar couplings identify long range correlated motions in the backbone of the protein ubiquitin
2kqs	Phosphorylation of SUMO-interacting motif by CK2 enhances Daxx SUMO binding activity
2ktf	Solution NMR structure of human polymerase iota UBM2 in complex with ubiquitin
2kwu	Solution Structure of UBM2 of murine Polymerase iota in Complex with Ubiquitin
2kwv	Solution Structure of UBM1 of murine Polymerase iota in Complex with Ubiquitin
2kx0	the solution structure of UBB+1, frameshift mutant of ubiquitin B
2kx3	The solution structure of the mutant of UBL domain of UBLCP1, I5M
2l00	Solution structure of the non-covalent complex of the ZNF216 A20 domain with ubiquitin
2l0f	Solution NMR structure of human polymerase iota UBM2 (P692A mutant) in complex with ubiquitin
2l0t	Solution structure of the complex of ubiquitin and the VHS domain of Stam2
2l3z	Proton-Detected 4D DREAM Solid-State NMR Structure of Ubiquitin
2l76	Solution NMR structure of human NFATC2IP ubiquitin-like domain, NFATC2IP_244_338, NESG target HT65A/OCSP target hs00387_244_338/SGC-toronto
2l7r	Solution NMR structure of N-terminal Ubiquitin-like domain of FUBI, a ribosomal protein S30 precursor from Homo sapiens. NorthEast Structural Genomics consortium (NESG) target HR6166
2las	Molecular Determinants of Paralogue-Specific SUMO-SIM Recognition
2ld9	Backbone Structure of Ubiquitin determined using Backbone amide NOEs and Backbone N-H and N-C RDCs
2lgd	The high resolution structure of ubiquitin like domain of UBLCP1
2lj5	Description of the Structural fluctuations of proteins from structure-based calculations of Residual dipolar couplings
2lrw	Solution structure of a ubiquitin-like protein from Trypanosoma brucei
2lvo	Structure of the gp78CUE domain bound to monubiquitin
2lvp	gp78CUE domain bound to the distal ubiquitin of K48-linked diubiquitin
2lvq	gp78CUE domain bound to the proximal ubiquitin of K48-linked diubiquitin
2lwp	The NMR solution structure of the the ubiquitin homology domain of mouse BAG-1
2lxa	Solution structure of the Get5 ubiquitin-like domain
2lxc	Solution structure of the complex between the Sgt2 homodimerization domain and the Get5 UBL domain
2lz6	Distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications
2m0x	Solution structure of U14Ub1, an engineered ubiquitin variant with increased affinity for USP14
2m17	ubiquitin-like domain-containing C-terminal domain phosphatase (UBLCP1)
2m8s	NMR Structure of the Cytoplasmic Tail of the Membrane Form of Heparin-binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-associated Athanogene 1 from Mus musculus (mBAG-1-UBH)
2ma9	HIV-1 Vif SOCS-box and Elongin BC solution structure
2mbb	2MBB
2mbe	2MBE
2mbh	NMR structure of EKLF(22-40)/Ubiquitin Complex
2mbo	K11-linked Diubiquitin average solution structure at pH 6.8, 0 mM NaCl
2mbq	K11-linked Diubiquitin average solution structure at pH 6.8, 150 mM NaCl
2mcn	Distinct ubiquitin binding modes exhibited by SH3 domains: molecular determinants and functional implications
2mi8	Solution structure of lysine-free (K0) ubiquitin
2mj5	Structure of the UBA Domain of Human NBR1 in Complex with Ubiquitin
2mjb	Solution nmr structure of ubiquitin refined against dipolar couplings in 4 media
2mlb	2MLB
2mor	2MOR
2mp2	2MP2
2mqj	2MQJ
2mre	2MRE
2mro	2MRO
2msg	2MSG
2mur	2MUR
2mw5	2MW5
2mws	2MWS
2n13	2N13
2n1a	2N1A
2n1v	2N1V
2n1w	2N1W
2n2k	2N2K
2n3u	2N3U
2n3v	2N3V
2n3w	2N3W
2n4f	2N4F
2n7k	2N7K
2n9e	2N9E
2n9p	2N9P
2nbd	2NBD
2nbe	2NBE
2nbu	2NBU
2nbv	2NBV
2nbw	2NBW
2nr2	The MUMO (minimal under-restraining minimal over-restraining) method for the determination of native states ensembles of proteins
2nvu	Structure of APPBP1-UBA3~NEDD8-NEDD8-MgATP-Ubc12(C111A), a trapped ubiquitin-like protein activation complex
2o6v	Crystal structure and solution NMR studies of Lys48-linked tetraubiquitin at neutral pH
2ojr	Structure of ubiquitin solved by SAD using the Lanthanide-Binding Tag
2oob	crystal structure of the UBA domain from Cbl-b ubiquitin ligase in complex with ubiquitin
2pe6	Non-covalent complex between human SUMO-1 and human Ubc9
2pe9	NMR Based Structure of the Open Conformation of LYS48-Linked Di-UBiquitin Using Experimental Global Rotational Diffusion Tensor from NMR Relaxation Measurements
2pea	NMR Based Structure of the Closed Conformation of LYS48-Linked Di-Ubiquitin Using Experimental Global Rotational Diffusion Tensor from NMR Relaxation Measurements
2qho	Crystal structure of the UBA domain from EDD ubiquitin ligase in complex with ubiquitin
2rpq	Solution Structure of a SUMO-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
2rr9	The solution structure of the K63-Ub2:tUIMs complex
2rsu	Alternative structure of Ubiquitin
2ru6	The pure alternative state of ubiquitin
2uyz	Non-covalent complex between Ubc9 and SUMO1
2vrr	Structure of SUMO modified Ubc9
2w9n	crystal structure of linear di-ubiquitin
2wdt	Crystal structure of Plasmodium falciparum UCHL3 in complex with the suicide inhibitor UbVME
2wwz	TAB2 NZF DOMAIN IN COMPLEX WITH Lys63-linked di-ubiquitin, P212121
2wx0	TAB2 NZF DOMAIN IN COMPLEX WITH Lys63-linked di-ubiquitin, P21
2wx1	TAB2 NZF DOMAIN IN COMPLEX WITH Lys63-linked tri-ubiquitin, P212121
2wyq	THE CRYSTAL STRUCTURE OF THE UBIQUITIN-LIKE (UBL) DOMAIN OF HHR23A ( HUMAN HOMOLOGUE A OF RAD23)
2xbb	Nedd4 HECT:Ub complex
2xew	Crystal structure of K11-linked diubiquitin
2xk5	Crystal structure of K6-linked diubiquitin
2y5b	Structure of USP21 in complex with linear diubiquitin-aldehyde
2z59	Complex Structures of Mouse Rpn13 (22-130aa) and ubiquitin
2zcb	Crystal Structure of ubiquitin P37A/P38A
2zcc	Ubiquitin crystallized under high pressure
2zeq	Crystal structure of ubiquitin-like domain of murine Parkin
2znv	Crystal structure of human AMSH-LP DUB domain in complex with Lys63-linked ubiquitin dimer
2zvn	NEMO CoZi domain incomplex with diubiquitin in P212121 space group
2zvo	NEMO CoZi domain in complex with diubiquitin in C2 space group
3a1q	Crystal structure of the mouse RAP80 UIMs in complex with Lys63-linked di-ubiquitin
3a33	UbcH5b~Ubiquitin Conjugate
3a9j	Crystal structure of the mouse TAB2-NZF in complex with Lys63-linked di-ubiquitin
3a9k	Crystal structure of the mouse TAB3-NZF in complex with Lys63-linked di-ubiquitin
3ai5	Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
3alb	Cyclic Lys48-linked tetraubiquitin
3aul	Crystal structure of wild-type Lys48-linked diubiquitin in an open conformation
3axc	Crystal structure of linear diubiquitin
3b08	Crystal structure of the mouse HOIL1-L-NZF in complex with linear di-ubiquitin
3b0a	Crystal structure of the mouse HOIL1-L-NZF in complex with linear di-ubiquitin
3b1l	Crystal Structure of parkin ubiquitin-like domain R33Q mutant
3by4	Structure of Ovarian Tumor (OTU) domain in complex with Ubiquitin
3c0r	Structure of Ovarian Tumor (OTU) domain in complex with Ubiquitin
3cmm	Crystal Structure of the Uba1-Ubiquitin Complex
3dbh	Structural Dissection of a Gating Mechanism Preventing Misactivation of Ubiquitin by NEDD8's E1 (APPBP1-UBA3Arg190Ala-NEDD8Ala72Arg)
3dbl	Structural Dissection of a Gating Mechanism Preventing Misactivation of Ubiquitin by NEDD8's E1 (APPBP1-UBA3Arg190wt-NEDD8Ala72Gln)
3dbr	Structural Dissection of a Gating Mechanism Preventing Misactivation of Ubiquitin by NEDD8's E1 (APPBP1-UBA3Arg190Gln-NEDD8Ala72Arg)
3dcg	Crystal Structure of the HIV Vif BC-box in Complex with Human ElonginB and ElonginC
3dqv	Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation
3dvg	Crystal structure of K63-specific fab Apu.3A8 bound to K63-linked di-ubiquitin
3dvn	Crystal structure of K63-specific fab Apu2.16 bound to K63-linked di-ubiquitin
3eec	X-ray structure of human ubiquitin Cd(II) adduct
3efu	X-ray structure of human ubiquitin-Hg(II) adduct
3ehv	X-ray structure of human ubiquitin Zn(II) adduct
3gzn	Structure of NEDD8-activating enzyme in complex with NEDD8 and MLN4924
3h1u	Structure of ubiquitin in complex with Cd ions
3h7p	Crystal structure of K63-linked di-ubiquitin
3h7s	Crystal structures of K63-linked di- and tri-ubiquitin reveal a highly extended chain architecture
3hm3	The Structure and conformation of Lys-63 linked tetra-ubiquitin
3i3t	Crystal structure of covalent ubiquitin-USP21 complex
3ifw	Crystal structure of the S18Y variant of ubiquitin carboxy terminal hydrolase L1 bound to ubiquitin vinylmethylester.
3ihp	Covalent Ubiquitin-Usp5 Complex
3ix6	Crystal structure of Thymidylate synthase thyA from Brucella melitensis
3j6x	3J6X
3j6y	3J6Y
3j77	3J77
3j78	3J78
3j79	3J79
3j7o	3J7O
3j7p	3J7P
3j7q	3J7Q
3j7r	3J7R
3j80	3J80
3j81	3J81
3j92	3J92
3jam	3JAM
3jap	3JAP
3jaq	3JAQ
3jsv	Crystal structure of mouse NEMO CoZi in complex with Lys63-linked di-ubiquitin
3jvz	E2~Ubiquitin-HECT
3jw0	E2~Ubiquitin-HECT
3k9o	The crystal structure of E2-25K and UBB+1 complex
3k9p	The crystal structure of E2-25K and ubiquitin complex
3kvf	Crystal structure of the I93M mutant of ubiquitin carboxy terminal hydrolase L1 bound to ubiquitin vinylmethylester
3kw5	Crystal structure of ubiquitin carboxy terminal hydrolase L1 bound to ubiquitin vinylmethylester
3kyc	Human SUMO E1 complex with a SUMO1-AMP mimic
3kyd	Human SUMO E1~SUMO1-AMP tetrahedral intermediate mimic
3l0w	Structure of split monoubiquitinated PCNA with ubiquitin in position two
3l10	Structure of split monoubiquitinated PCNA with ubiquitin in position one
3ldz	Crystal structure of human STAM1 VHS domain in complex with ubiquitin
3m3j	A new crystal form of Lys48-linked diubiquitin
3m62	Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Rad23
3m63	Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Dsk2
3mhs	Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module bound to ubiquitin aldehyde
3mtn	Usp21 in complex with a ubiquitin-based, USP21-specific inhibitor
3n30	Crystal Structure of cubic Zn3-hUb (human ubiquitin) adduct
3n32	The crystal structure of human Ubiquitin adduct with Zeise's salt
3n3k	The catalytic domain of USP8 in complex with a USP8 specific inhibitor
3nhe	High Resolution Structure (1.26A) of USP2a in Complex with Ubiquitin
3nob	Structure of K11-linked di-ubiquitin
3ns8	Crystal structure of an open conformation of Lys48-linked diubiquitin at pH 7.5
3o65	Crystal structure of a Josephin-ubiquitin complex: Evolutionary restraints on ataxin-3 deubiquitinating activity
3ofi	Crystal structure of human insulin-degrading enzyme in complex with ubiquitin
3oj3	Crystal structure of the A20 ZnF4 and ubiquitin complex
3oj4	Crystal structure of the A20 ZnF4, ubiquitin and UbcH5A complex
3olm	Structure and Function of a Ubiquitin Binding Site within the Catalytic Domain of a HECT Ubiquitin Ligase
3ons	Crystal structure of Human Ubiquitin in a new crystal form
3pge	Structure of sumoylated PCNA
3phd	Crystal structure of human HDAC6 in complex with ubiquitin
3phw	OTU Domain of Crimean Congo Hemorrhagic Fever Virus in complex with Ubiquitin
3phx	OTU Domain of Crimean Congo Hemorrhagic Fever Virus in complex with ISG15
3plu	Structure of Hub-1 protein in complex with Snu66 peptide (HINDI)
3plv	Structure of Hub-1 protein in complex with Snu66 peptide (HINDII)
3prm	Structural analysis of a viral OTU domain protease from the Crimean-Congo Hemorrhagic Fever virus in complex with human ubiquitin
3prp	Structural analysis of a viral OTU domain protease from the Crimean-Congo Hemorrhagic Fever virus in complex with human ubiquitin
3pse	Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15)
3pt2	Structure of a viral OTU domain protease bound to Ubiquitin
3ptf	X-ray structure of the non-covalent complex between UbcH5A and Ubiquitin
3q3f	Engineering Domain-Swapped Binding Interfaces by Mutually Exclusive Folding: Insertion of Ubiquitin into position 103 of Barnase
3qht	Crystal Structure of the Monobody ySMB-1 bound to yeast SUMO
3r66	Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza virus B, Northeast Structural Genomics Consortium Target IDs HX6481, HR2873, and OR2
3rt3	Complex of influenza virus protein with host anti-viral factor
3rul	New strategy to analyze structures of glycopeptide-target complexes
3rzw	Crystal Structure of the Monobody ySMB-9 bound to human SUMO1
3sdl	Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B virus, Northeast Structural Genomics Consortium Target IDs HX6481, HR2873, and OR2
3shq	Crystal Structure of UBLCP1
3tbl	Structure of Mono-ubiquitinated PCNA: Implications for DNA Polymerase Switching and Okazaki Fragment Maturation
3tix	Crystal structure of the Chp1-Tas3 complex core
3tmp	The catalytic domain of human deubiquitinase DUBA in complex with ubiquitin aldehyde
3u30	Crystal structure of a linear-specific Ubiquitin fab bound to linear ubiquitin
3uf8	Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with a G95A surface mutation from Burkholderia pseudomallei complexed with FK506
3ugb	UbcH5c~Ubiquitin Conjugate
3uin	Complex between human RanGAP1-SUMO2, UBC9 and the IR1 domain from RanBP2
3uio	Complex between human RanGAP1-SUMO2, UBC9 and the IR1 domain from RanBP2 containing IR2 Motif II
3uip	Complex between human RanGAP1-SUMO1, UBC9 and the IR1 domain from RanBP2 containing IR2 Motif II
3uqa	Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface mutation A54E from Burkholderia pseudomallei complexed with FK506
3uqb	Crystal structure of a SMT Fusion PEPTIDYL-PROLYL CIS-TRANS ISOMERASE with surface mutation D44G from Burkholderia pseudomallei complexed with FK506
3v60	Structure of S. cerevisiae PCNA conjugated to SUMO on lysine 164
3v61	Structure of S. cerevisiae PCNA conjugated to SUMO on lysine 164
3v62	Structure of the S. cerevisiae Srs2 C-terminal domain in complex with PCNA conjugated to SUMO on lysine 164
3v6c	Crystal Structure of USP2 in complex with mutated ubiquitin
3v6e	Crystal Structure of USP2 and a mutant form of Ubiquitin
3v7o	Crystal structure of the C-terminal domain of Ebola virus VP30 (strain Reston-89)
3vaw	Crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase with surface mutation v3i from burkholderia pseudomallei complexed with fk506
3vdz	Tailoring Encodable Lanthanide-Binding Tags as MRI Contrast Agents: xq-dSE3-Ubiquitin at 2.4 Angstroms
3vfk	The structure of monodechloro-teicoplanin in complex with its ligand, using ubiquitin as a ligand carrier
3vht	Crystal structure of GFP-Wrnip1 UBZ domain fusion protein in complex with ubiquitin
3vuw	Crystal structure of A20 ZF7 in complex with linear ubiquitin, form I
3vux	Crystal structure of A20 ZF7 in complex with linear ubiquitin, form II
3vuy	Crystal structure of A20 ZF7 in complex with linear tetraubiquitin
3wwq	3WWQ
3wxe	3WXE
3wxf	3WXF
3wxg	3WXG
3zdm	Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
3zkj	Crystal Structure of Ankyrin Repeat and Socs Box-Containing Protein 9 (Asb9) in Complex with Elonginb and Elonginc
3zlz	Lys6-linked tri-ubiquitin
3zng	Ankyrin repeat and SOCS-box protein 9 (ASB9) in complex with ElonginB and ElonginC
3znh	Crimean Congo Hemorrhagic Fever Virus OTU domain in complex with ubiquitin-propargyl.
3zni	Structure of phosphoTyr363-Cbl-b - UbcH5B-Ub - ZAP-70 peptide complex
3znz	Crystal structure of OTULIN OTU domain (C129A) in complex with Met1- di ubiquitin
3zo5	Structure of SENP2-Loop1 in complex with preSUMO-2
3zrc	pVHL54-213-EloB-EloC complex (4R)-4-HYDROXY-1-[(3-METHYLISOXAZOL-5-YL)ACETYL]-N-[4-(1,3-OXAZOL-5-YL)BENZYL]-L-PROLINAMIDE bound
3zrf	pVHL54-213-EloB-EloC complex_apo
3ztc	pVHL54-213-EloB-EloC complex _ (2S,4R)-N-((1,1'-biphenyl)-4-ylmethyl)- 4-hydroxy-1-(2-(3-methylisoxazol-5-yl)acetyl)pyrrolidine-2- carboxamide
3ztd	pVHL54-213-EloB-EloC complex _ methyl 4-(((2S,4R)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
3zun	pVHL54-213-EloB-EloC complex_(2S,4R)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-N-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
4a20	Crystal structure of the Ubl domain of Mdy2 (Get5) at 1.78A
4adx	The Cryo-EM Structure of the Archaeal 50S Ribosomal Subunit in Complex with Initiation Factor 6
4ajy	von Hippel-Lindau protein-ElonginB-ElonginC complex, bound to Hif1- alpha peptide
4ap4	Rnf4 - ubch5a - ubiquitin heterotrimeric complex
4asw	Structure of the complex between the N-terminal dimerisation domain of Sgt2 and the UBL domain of Get5
4auq	Structure of BIRC7-UbcH5b-Ub complex.
4awj	pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
4b95	pVHL-EloB-EloC complex_(2S,4R)-1-(2-chlorophenyl)carbonyl-N-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
4b9k	pVHL-ELOB-ELOC complex_(2S,4R)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
4bbn	NEDD4 HECT-Ub:Ub complex
4bkg	crystal structure of human diSUMO-2
4bks	von Hippel Lindau protein:ElonginB:ElonginC complex, in complex with (2S,4R)-1-ethanoyl-N-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
4bkt	von Hippel Lindau protein:ElonginB:ElonginC complex, in complex with (2S,4R)-N-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl-pyrrolidine-2-carboxamide
4bos	Structure of OTUD2 OTU domain in complex with Ubiquitin K11-linked peptide
4boz	Structure of OTUD2 OTU domain in complex with K11-linked di ubiquitin
4bvu	Structure of Shigella effector OspG in complex with host UbcH5c- Ubiquitin conjugate
4d5l	4D5L
4d5y	4D5Y
4d61	4D61
4d67	4D67
4da1	Crystal structure of branched-chain alpha-ketoacid dehydrogenase phosphatase with Mg (II) ions at the active site
4ddg	Crystal structure of human OTUB1/UbcH5b~Ub/Ub
4ddi	Crystal structure of human OTUB1/UbcH5b~Ub/Ub
4dhj	The structure of a ceOTUB1 ubiquitin aldehyde UBC13~Ub complex
4dhz	The structure of h/ceOTUB1-ubiquitin aldehyde-UBC13~Ub
4dwf	Crystal structure of a HLA-B associated transcript 3 (BAT3) from Homo sapiens at 1.80 A resolution
4eew	Crystal structure of the Ubl domain of BAG6
4f8c	Structure of the Cif:Nedd8 complex - Yersinia pseudotuberculosis Cycle Inhibiting Factor in complex with human Nedd8
4fbj	Structure of the Cif:Nedd8 complex - Photorhabdus luminescens Cycle Inhibiting Factor in complex with human Nedd8
4fjv	Crystal Structure of Human Otubain2 and Ubiquitin Complex
4fn2	Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface mutation D44G from Burkholderia pseudomallei complexed with CJ37
4g50	Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface mutation D44G from Burkholderia pseudomallei complexed with CJ168
4ggq	Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with CJ40
4giv	Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface mutation D44G from Burkholderia pseudomallei complexed with CJ183
4goc	Crystal structure of the Get5 ubiquitin-like domain
4gsw	Crystal structure of ubiquitin from Entamoeba histolytica to 2.15 Angstrom
4gu2	Crystal structure of ubiquitin from Entamoeba histolytica to 1.35 Angstrom
4hcn	Crystal structure of Burkholderia pseudomallei effector protein CHBP in complex with ubiquitin
4hcp	crystal structure of Burkholderia pseudomallei effector protein chbp in complex with nedd8
4hjk	U7Ub7 Disulfide variant
4hk2	U7Ub25.2540
4hxd	Diversity of ubiquitin and ISG15 specificity amongst nairoviruses viral ovarian tumor domain proteases
4i6l	Crystal structure of OTUB1 in complex with ubiquitin variant
4i6n	Crystal structure of Trichinella spiralis UCH37 catalytic domain bound to Ubiquitin vinyl methyl ester
4ig7	Crystal structure of Trichinella spiralis UCH37 bound to Ubiquitin vinyl methyl ester
4ii2	Crystal structure of Ubiquitin activating enzyme 1 (Uba1) in complex with the Ub E2 Ubc4, ubiquitin, and ATP/Mg
4ii3	Crystal structure of S. pombe Ubiquitin activating enzyme 1 (Uba1) in complex with ubiquitin and ATP/Mg
4ium	Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
4jgh	Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
4jio	Bro1 V domain and ubiquitin
4jqw	Crystal Structure of a Complex of NOD1 CARD and Ubiquitin
4k1r	Crystal structure of Schizosaccharomyces pombe sst2 catalytic domain and Ubiquitin
4k7s	Crystal structure of Zn2-hUb (human ubiquitin) adduct from a solution 35 mM zinc acetate/1.3 mM hUb
4k7u	Crystal structure of Zn2.3-hUb (human ubiquitin) adduct from a solution 70 mM zinc acetate/1.3 mM hUb
4k7w	Crystal structure of Zn3-hUb(human ubiquitin) adduct from a solution 100 mM zinc acetate/1.3 mM hUb
4k95	Crystal Structure of Parkin
4ksk	Gumby/Fam105B in complex with ubiquitin
4ksl	Gumby/Fam105B in complex with linear di-ubiquitin
4kzx	Rabbit 40S ribosomal subunit in complex with eIF1.
4kzy	Rabbit 40S ribosomal subunit in complex with eIF1 and eIF1A.
4kzz	Rabbit 40S ribosomal subunit in complex with mRNA, initiator tRNA and eIF1A
4lcd	Structure of an Rsp5xUbxSna3 complex: Mechanism of ubiquitin ligation and lysine prioritization by a HECT E3
4ldt	The structure of h/ceOTUB1-ubiquitin aldehyde-UBCH5B~Ub
4ljo	Structure of an active ligase (HOIP)/ubiquitin transfer complex
4ljp	Structure of an active ligase (HOIP-H889A)/ubiquitin transfer complex
4m0w	Crystal Structure of SARS-CoV papain-like protease C112S mutant in complex with ubiquitin
4mdk	Cdc34-ubiquitin-CC0651 complex
4mm3	4MM3
4msm	4MSM
4msq	4MSQ
4n9f	Crystal structure of the Vif-CBFbeta-CUL5-ElOB-ElOC pentameric complex
4nnj	Crystal structure of Uba1 in complex with ubiquitin-AMP and thioesterified ubiquitin
4npn	4NPN
4nqk	Structure of an Ubiquitin complex
4nql	4NQL
4p4h	4P4H
4p5o	4P5O
4pig	4PIG
4pih	4PIH
4pij	4PIJ
4pqt	4PQT
4q5e	4Q5E
4q5h	4Q5H
4r62	4R62
4rf0	4RF0
4rf1	4RF1
4s1z	4S1Z
4s22	4S22
4uel	4UEL
4uf6	4UF6
4ug0	4UG0
4ujc	4UJC
4ujd	4UJD
4uje	4UJE
4un2	4UN2
4v3k	4V3K
4v3l	4V3L
4v7e	4V7E
4v88	4V88
4v8m	4V8M
4v8p	4V8P
4v8t	4V8T
4v8y	4V8Y
4v8z	4V8Z
4v91	4V91
4w9c	4W9C
4w9d	4W9D
4w9e	4W9E
4w9f	4W9F
4w9g	4W9G
4w9h	4W9H
4w9i	4W9I
4w9j	4W9J
4w9k	4W9K
4w9l	4W9L
4whv	4WHV
4wjn	4WJN
4wjo	4WJO
4wjp	4WJP
4wjq	4WJQ
4wlr	4WLR
4wqo	4WQO
4wur	4WUR
4wzp	4WZP
4xkh	4XKH
4xkl	4XKL
4xof	4XOF
4xok	4XOK
4xol	4XOL
4xyz	4XYZ
4y1h	4Y1H
4z9s	4Z9S
4zfr	4ZFR
4zft	4ZFT
4zpz	4ZPZ
4zqs	4ZQS
4zux	4ZUX
4zyn	4ZYN
5a5b	5A5B
5aek	5AEK
5af4	5AF4
5af5	5AF5
5af6	5AF6
5ait	5AIT
5aiu	5AIU
5aj0	5AJ0
5apn	5APN
5apo	5APO
5b83	5B83
5bnb	5BNB
5bo4	5BO4
5bz0	5BZ0
5c1z	5C1Z
5c23	5C23
5c7j	5C7J
5c7m	5C7M
5caw	5CAW
5chf	5CHF
5chv	5CHV
5chw	5CHW
5cra	5CRA
5cvm	5CVM
5cvn	5CVN
5cvo	5CVO
5d0k	5D0K
5d0m	5D0M
5d2m	5D2M
5d6j	5D6J
5dfl	5DFL
5dk8	5DK8
5e6j	5E6J
5edv	5EDV
5elj	5ELJ
5elu	5ELU
5emz	5EMZ
5eql	5EQL
5eya	5EYA
5fer	5FER
5flx	5FLX
5gak	5GAK
5gjq	5GJQ
5go7	5GO7
5go8	5GO8
5gob	5GOB
5goc	5GOC
5god	5GOD
5gog	5GOG
5goh	5GOH
5goi	5GOI
5goj	5GOJ
5gok	5GOK
5hpk	5HPK
5hpl	5HPL
5hps	5HPS
5hpt	5HPT
5ibk	5IBK
5ifr	5IFR
5j8p	5J8P
5jbv	5JBV
5jby	5JBY
5jg6	5JG6
5jne	5JNE
5jp1	5JP1
5jp3	5JP3
5jqs	5JQS
5jtj	5JTJ
5jtv	5JTV
5juo	5JUO
5jup	5JUP
5jus	5JUS
5jut	5JUT
5juu	5JUU
5jze	5JZE
5k9p	5K9P
5kgf	5KGF
5khy	5KHY
5l8h	5L8H
5l8w	5L8W
5l9t	5L9T
5l9u	5L9U
5lli	5LLI
5ln1	5LN1
5lrv	5LRV
5lrw	5LRW
5lrx	5LRX
5lzs	5LZS
5lzt	5LZT
5lzu	5LZU
5lzv	5LZV
5lzw	5LZW
5lzx	5LZX
5lzy	5LZY
5lzz	5LZZ

Links (links to other resources describing this domain)

• PROSITE: UBQ_DOMAIN
• PFAM: ubiquitin
• INTERPRO: IPR000626