The domain within your query sequence starts at position 352 and ends at position 389; the E-value for the WD40 domain shown below is 9.67e-7.

DITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWS

WD40

WD40 repeats

• SMART accession number: SM00320
• Description: Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.
• Interpro abstract (IPR001680):

  WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein or protein-DNA interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins [ (PUBMED:30069656) ]. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [ (PUBMED:11814058) (PUBMED:10322433) ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events.

• GO function: protein binding (GO:0005515)

There are 1918936 WD40 domains in 345139 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Cellular role: signalling

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Garcia-Higuera I et al.
• Folding of proteins with WD-repeats: comparison of six members of the WD-repeat superfamily to the G protein beta subunit.
• Biochemistry. 1996; 35: 13985-94

The family of WD-repeat proteins comprises over 30 different proteins that share a highly conserved repeating motif [Neer, E. J., Schmidt, C. J., Nambudripad, R., & Smith, T. F. (1994) Nature 371, 297-300]. Members of this family include the signal-transducing G protein beta subunit, as well as other proteins that regulate signal transduction, transcription, pre-mRNA splicing, cytoskeletal organization, and vesicular fusion. The crystal structure of one WD-repeat protein (G beta) has now been solved (Wall et al., 1995; Sondek et al, 1996) and reveals that the seven repeating units form a circular, propeller-like structure with seven blades each made up of four beta strands. It is very likely that all WD-repeat proteins form a similar structure. If so, it will be possible to use information about important surface regions of one family member to predict properties of another. If WD proteins form structures similar to G beta, their hydrodynamic properties should be those of compact, globular proteins, and they should be resistant to cleavage by trypsin. However, the only studied example of a WD-repeat protein, G beta, synthesized in vitro in a rabbit reticulocyte lysate, is unable to fold into a native structure without its partner protein G gamma. The non-WD-repeat amino terminal alpha helix of G beta does not inhibit folding because G beta does not fold even when this region is removed. It is not known whether all WD-repeat proteins are unable to fold when synthesized in an in vitro system. We synthesized seven members of the family in a rabbit reticulocyte lysate, determined their Stokes radius, sedimentation coefficient, and frictional ratio, and assayed their stability to trypsin. Our working definition of folding was that the proteins from globular, trypsin-resistant structures because, except for G beta gamma, their functions are not known or cannot be assayed in reticulocyte lysates. We chose proteins that include amino and carboxyl extensions as well as proteins that are made up entirely of WD-repeats. We show that unlike G beta, several proteins with WD-repeats are able to fold into globular proteins in a rabbit reticulocyte lysate. One protein, beta Trcp, formed large aggregates like G beta, suggesting that it may also require a partner protein. Despite the presence of many potential tryptic cleavage sites, all of the proteins that did fold gave stable large products on tryptic proteolysis, as predicted on the basis of the structure of G beta. These studies suggest that other WD-repeat proteins are likely to form propeller structures similar to G beta.

• Sondek J, Bohm A, Lambright DG, Hamm HE, Sigler PB
• Crystal structure of a G-protein beta gamma dimer at 2.1A resolution.
• Nature. 1996; 379: 369-74

Many signalling cascades use seven-helical transmembrane receptors coupled to heterotrimeric G proteins (G alpha beta gamma) to convert extracellular signals into intracellular responses. Upon nucleotide exchange catalysed by activated receptors, heterotrimers dissociate into GTP-bound G alpha subunits and G beta gamma dimers, either of which can modulate many downstream effectors. Here we use multiwavelength anomalous diffraction data to solve the crystal structure of the beta gamma dimer of the G protein transducin. The beta-subunit is primarily a seven-bladed beta-propeller that is partially encircled by an extended gamma-subunit. The beta-propeller, which contains seven structurally similar WD repeats, defines the stereochemistry of the WD repeat and the probable architecture of all WD-repeat-containing domains. The structure details interactions between G protein beta- and gamma-subunits and highlights regions implicated in effector modulation for the conserved family of G protein beta gamma dimers.

• Dynlacht BD, Weinzierl RO, Admon A, Tjian R
• The dTAFII80 subunit of Drosophila TFIID contains beta-transducin repeats.
• Nature. 1993; 363: 176-9

A key component of the RNA polymerase II transcriptional apparatus, TFIID, is a multi-protein complex containing the TATA box-binding protein (TBP) and at least seven tightly associated factors (TAFs). Although the functions of most TFIID subunits are unknown, it is clear that TAFs are not necessary for basal activity but that one or more are required for regulated transcription, and so behave as coactivators. The presence of multiple subunits indicates that there is an intricate assembly process and that TAFs may be responsible for other activities. We have described the properties of the subunit dTAFII110, which can interact directly with the transcriptional activator Sp1 (ref. 5). In addition, the largest subunit, dTAFII250, binds directly to TBP and links other TAFs to the complex. Here we describe the cloning, expression and partial characterization of the Drosophila TAF of M(r) 80,000, dTAFII80. Sequence analysis reveals that dTAFII80 contains several copies of the WD40 (beta-transducin) repeat. Moreover, dTAFII80 shares extended sequence similarity with an Arabidopsis gene, COP1, which encodes a putative transcription factor that is though to regulate development. We have expressed recombinant dTAFII80 and begun to characterize its interaction with other members of the TFIID complex. Purified recombinant dTAFII80 is unable to bind TBP directly or to interact strongly with the C-terminal domain of dTAFII250 (delta N250). Instead, dTAFII80 is only able to recognize and interact with a higher-order complex containing TBP, delta N250, 110 and 60. These findings suggest the formation of TFIID may require an ordered assembly of the TAFs, some of which bind directly to TBP and others that are tethered to the complex as a result of specific TAF/TAF interactions.

• Fong HK et al.
• Repetitive segmental structure of the transducin beta subunit: homology with the CDC4 gene and identification of related mRNAs.
• Proc Natl Acad Sci U S A. 1986; 83: 2162-6

Retinal transducin, a guanine nucleotide regulatory protein (referred to as a G protein) that activates a cGMP phosphodiesterase in photoreceptor cells, is comprised of three subunits. We have identified and analyzed cDNA clones of the bovine transducin beta subunit that may be highly conserved or identical to that in other G proteins. From the cDNA nucleotide sequence of the entire coding region, the primary structure of a 340-amino acid protein was deduced. The encoded beta subunit has a Mr of 37,375 and is comprised of repetitive homologous segments arranged in tandem. Furthermore, significant homology in primary structure and segmental sequence exists between the beta subunit and the yeast CDC4 gene product. The Mr 37,375 beta subunit polypeptide is encoded by a 2.9-kilobase (kb) mRNA. However, there exists in retina other beta-related mRNAs that are divergent from the 2.9-kb mRNA on the basis of oligonucleotide and primer-extended probe hybridizations. All mammalian tissues and clonal cell lines that have been examined contain at least two beta-related mRNAs, usually 1.8 and 2.9 kb in length. These results suggest that the mRNAs are the processed products of a small number of closely related genes or of a single highly complex beta gene.

Disease (disease genes where sequence variants are found in this domain)

SwissProt sequences and OMIM curated human diseases associated with missense mutations within the WD40 domain.

Protein	Disease
Peroxisomal targeting signal 2 receptor (O00628) (SMART)	OMIM:601757: Rhizomelic chondrodysplasia punctata, type 1 OMIM:215100:
Platelet-activating factor acetylhydrolase IB subunit alpha (P43034) (SMART)	OMIM:601545: Lissencephaly-1 ; Subcortical laminar heterotopia OMIM:247200: Miller-Dieker lissencephaly syndrome
DNA damage-binding protein 2 (Q92466) (SMART)	OMIM:600811: Xeroderma pigmentosum, group E, DDB-negative subtype OMIM:278740:

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
15.71	map04120	Ubiquitin mediated proteolysis
10.79	map04111	Cell cycle - yeast
9.05	map04310	Wnt signaling pathway
7.06	map04110	Cell cycle
6.13	map04530	Tight junction
4.93	map04810	Regulation of actin cytoskeleton
4.53	map04150	mTOR signaling pathway
3.99	map03022	Basal transcription factors
3.99	map04350	TGF-beta signaling pathway
3.99	map04730	Long-term depression
3.60	map04115	p53 signaling pathway
2.66	map04340	Hedgehog signaling pathway
2.53	map04140	Regulation of autophagy
2.40	map04080	Neuroactive ligand-receptor interaction
2.13	map04914	Progesterone-mediated oocyte maturation
2.00	map04910	Insulin signaling pathway
1.60	map00565	Ether lipid metabolism
1.46	map04742	Taste transduction
1.46	map04210	Apoptosis
1.33	map05222	Small cell lung cancer
1.33	map00632	Benzoate degradation via CoA ligation
0.93	map00562	Inositol phosphate metabolism
0.40	map00350	Tyrosine metabolism
0.40	map00340	Histidine metabolism
0.40	map00642	Ethylbenzene degradation
0.40	map00564	Glycerophospholipid metabolism
0.40	map00960	Alkaloid biosynthesis II
0.40	map00903	Limonene and pinene degradation
0.40	map00310	Lysine degradation
0.40	map00360	Phenylalanine metabolism
0.40	map00624	1- and 2-Methylnaphthalene degradation
0.40	map00380	Tryptophan metabolism
0.27	map00910	Nitrogen metabolism
0.27	map05210	Colorectal cancer
0.13	map04370	VEGF signaling pathway
0.13	map04662	B cell receptor signaling pathway
0.13	map04020	Calcium signaling pathway
0.13	map04720	Long-term potentiation
0.13	map03060	Protein export
0.13	map04360	Axon guidance
0.13	map04010	MAPK signaling pathway
0.13	map00100	Biosynthesis of steroids
0.13	map00561	Glycerolipid metabolism
0.13	map02010	ABC transporters - General
0.13	map04660	T cell receptor signaling pathway
0.13	map00230	Purine metabolism
0.13	map04330	Notch signaling pathway
0.13	map04650	Natural killer cell mediated cytotoxicity

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with WD40 domain which could be assigned to a KEGG orthologous group, and not all proteins containing WD40 domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of WD40 domains in PDB

PDB code	Title
1a0r	HETEROTRIMERIC COMPLEX OF PHOSDUCIN/TRANSDUCIN BETA-GAMMA
1b9x	STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN
1b9y	STRUCTURAL ANALYSIS OF PHOSDUCIN AND ITS PHOSPHORYLATION-REGULATED INTERACTION WITH TRANSDUCIN BETA-GAMMA
1erj	CRYSTAL STRUCTURE OF THE C-TERMINAL WD40 DOMAIN OF TUP1
1gg2	G PROTEIN HETEROTRIMER MUTANT GI_ALPHA_1(G203A) BETA_1 GAMMA_2 WITH GDP BOUND
1got	HETEROTRIMERIC COMPLEX OF A GT-ALPHA/GI-ALPHA CHIMERA AND THE GT-BETA-GAMMA SUBUNITS
1gp2	G PROTEIN HETEROTRIMER GI_ALPHA_1 BETA_1 GAMMA_2 WITH GDP BOUND
1gxr	WD40 Region of Human Groucho/TLE1
1k8k	Crystal Structure of Arp2/3 Complex
1nex	Crystal Structure of ScSkp1-ScCdc4-CPD peptide complex
1nr0	Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. elegans Homologue Of Yeast Actin Interacting Protein 1 (AIP1).
1omw	Crystal Structure of the complex between G Protein-Coupled Receptor Kinase 2 and Heterotrimeric G Protein beta 1 and gamma 2 subunits
1p22	Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase
1pev	Crystal Structure of the Actin Interacting Protein from Caenorhabditis Elegans
1pgu	YEAST ACTIN INTERACTING PROTEIN 1 (AIP1), Se-Met PROTEIN, MONOCLINIC CRYSTAL FORM
1pi6	YEAST ACTIN INTERACTING PROTEIN 1 (Aip1), ORTHORHOMBIC CRYSTAL FORM
1r5m	Crystal Structure Of The C-Terminal WD40 Domain Of Sif2
1s4u	Crystal Structure analysis of the beta-propeller protein Ski8p
1sq9	Structure of Ski8p, a WD repeat protein involved in mRNA degradation and meiotic recombination
1tbg	BETA-GAMMA DIMER OF THE HETEROTRIMERIC G-PROTEIN TRANSDUCIN
1trj	Homology Model of Yeast RACK1 Protein fitted into 11.7A cryo-EM map of Yeast 80S Ribosome
1tyq	Crystal structure of Arp2/3 complex with bound ATP and calcium
1u2v	Crystal structure of Arp2/3 complex with bound ADP and calcium
1u4c	Structure of spindle checkpoint protein Bub3
1vyh	PAF-AH Holoenzyme: Lis1/Alfa2
1xhm	The Crystal Structure of a Biologically Active Peptide (SIGK) Bound to a G Protein Beta:Gamma Heterodimer
1yfq	High resolution S. cerevisiae Bub3 mitotic checkpoint protein
2aq5	Crystal Structure of Murine Coronin-1
2b4e	Crystal Structure of Murine Coronin-1: monoclinic form
2bcj	Crystal Structure of G Protein-Coupled Receptor Kinase 2 in Complex with Galpha-q and Gbetagamma Subunits
2ce8	An EH1 peptide bound to the Groucho-TLE WD40 domain.
2ce9	A WRPW peptide bound to the Groucho-TLE WD40 domain.
2cnx	WDR5 and Histone H3 Lysine 4 dimethyl complex at 2.1 angstrom
2co0	WDR5 and unmodified Histone H3 complex at 2.25 angstrom
2g99	Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
2g9a	Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
2gnq	Structure of wdr5
2h13	Crystal structure of WDR5/histone H3 complex
2h14	Crystal of WDR5 (apo-form)
2h68	Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex
2h6k	Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex
2h6n	Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex
2h6q	Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex
2h9l	WDR5delta23
2h9m	WDR5 in complex with unmodified H3K4 peptide
2h9n	WDR5 in complex with monomethylated H3K4 peptide
2h9p	WDR5 in complex with trimethylated H3K4 peptide
2hes	Cytosolic Iron-sulphur Assembly Protein- 1
2i3s	Bub3 complex with Bub1 GLEBS motif
2i3t	Bub3 complex with Mad3 (BubR1) GLEBS motif
2o9k	WDR5 in Complex with Dimethylated H3K4 Peptide
2oit	Crystal Structure of the N-terminal Domain of the Human Proto-oncogene Nup214/CAN
2ovp	Structure of the Skp1-Fbw7 complex
2ovq	Structure of the Skp1-Fbw7-CyclinEdegC complex
2ovr	Structure of the Skp1-Fbw7-CyclinEdegN complex
2p9i	Crystal Structure of bovine Arp2/3 Complex co-crystallized with ADP and crosslinked with gluteraldehyde
2p9k	Crystal structure of bovine Arp2/3 complex co-crystallized with ATP and crosslinked with glutaraldehyde
2p9l	Crystal Structure of bovine Arp2/3 complex
2p9n	Crystal Structure of bovine Arp2/3 complex co-crystallized with ADP
2p9p	Crystal Structure of bovine Arp2/3 complex co-crystallized with ADP
2p9s	Structure of bovine Arp2/3 complex co-crystallized with ATP/Mg2+
2p9u	Crystal structure of bovine Arp2/3 complex co-crystallized with AMP-PNP and calcium
2pbi	The multifunctional nature of Gbeta5/RGS9 revealed from its crystal structure
2pm6	Crystal Structure of yeast Sec13/31 edge element of the COPII vesicular coat, native version
2pm7	Crystal structure of yeast Sec13/31 edge element of the COPII vesicular coat, selenomethionine version
2pm9	Crystal structure of yeast Sec13/31 vertex element of the COPII vesicular coat
2qxv	Structural basis of EZH2 recognition by EED
2trc	PHOSDUCIN/TRANSDUCIN BETA-GAMMA COMPLEX
2vdu	Structure of trm8, m7G methylation enzyme
2xl2	WDR5 IN COMPLEX WITH AN RBBP5 PEPTIDE RECRUITED TO NOVEL SITE
2xl3	WDR5 IN COMPLEX WITH AN RBBP5 PEPTIDE AND HISTONE H3 PEPTIDE
2xu7	Structural basis for RbAp48 binding to FOG-1
2xyi	Crystal Structure of Nurf55 in complex with a H4 peptide
2yb8	Crystal structure of Nurf55 in complex with Su(z)12
2yba	Crystal structure of Nurf55 in complex with histone H3
2ymu	Structure of a highly repetitive propeller structure
2ynn	yeast betaprime COP 1-304 with KTKTN motif
2yno	yeast betaprime COP 1-304H6
2ynp	yeast betaprime COP 1-604 with KTKTN motif
3acp	Crystal Structure of Yeast Rpn14, a Chaperone of the 19S Regulatory Particle of the Proteasome
3ah8	Structure of heterotrimeric G protein Galpha-q beta gamma in complex with an inhibitor YM-254890
3bg0	Architecture of a Coat for the Nuclear Pore Membrane
3bg1	Architecture of a Coat for the Nuclear Pore Membrane
3c99	Structural Basis of Histone H4 Recognition by p55
3c9c	Structural Basis of Histone H4 Recognition by p55
3cfs	Structural basis of the interaction of RbAp46/RbAp48 with histone H4
3cfv	Structural basis of the interaction of RbAp46/RbAp48 with histone H4
3cik	Human GRK2 in Complex with Gbetagamma subunits
3dm0	Maltose Binding Protein fusion with RACK1 from A. thaliana
3dw8	Structure of a Protein Phosphatase 2A Holoenzyme with B55 subunit
3dwl	Crystal Structure of Fission Yeast Arp2/3 Complex Lacking the Arp2 Subunit
3dxk	Structure of Bos Taurus Arp2/3 Complex with Bound Inhibitor CK0944636
3dxm	Structure of Bos taurus Arp2/3 Complex with Bound Inhibitor CK0993548
3eg6	Structure of WDR5 bound to MLL1 peptide
3ei1	Structure of hsDDB1-drDDB2 bound to a 14 bp 6-4 photoproduct containing DNA-duplex
3ei2	Structure of hsDDB1-drDDB2 bound to a 16 bp abasic site containing DNA-duplex
3ei3	Structure of the hsDDB1-drDDB2 complex
3ei4	Structure of the hsDDB1-hsDDB2 complex
3emh	Structural basis of WDR5-MLL interaction
3ewe	Crystal Structure of the Nup85/Seh1 Complex
3f3f	Crystal structure of the nucleoporin pair Nup85-Seh1, space group P21
3f3g	Crystal structure of the nucleoporin pair Nup85-Seh1, space group P212121
3f3p	Crystal structure of the nucleoporin pair Nup85-Seh1, space group P21212
3fhc	Crystal structure of human Dbp5 in complex with Nup214
3fm0	Crystal structure of WD40 protein Ciao1
3fmo	Crystal structure of the nucleoporin Nup214 in complex with the DEAD-box helicase Ddx19
3fmp	Crystal structure of the nucleoporin Nup214 in complex with the DEAD-box helicase Ddx19
3frx	Crystal Structure of the Yeast Orthologue of RACK1, Asc1.
3gfc	Crystal Structure of Histone-binding protein RBBP4
3gre	Crystal structure of Saccharomyces cerevisiae Vps15 WD repeat domain
3i2n	Crystal Structure of WD40 repeats protein WDR92
3iiw	Crystal structure of Eed in complex with a trimethylated histone H3K27 peptide
3iiy	Crystal structure of Eed in complex with a trimethylated histone H1K26 peptide
3ij0	Crystal structure of Eed in complex with a trimethylated histone H3K9 peptide
3ij1	Crystal structure of Eed in complex with a trimethylated histone H4K20 peptide
3ijc	Crystal structure of Eed in complex with NDSB-195
3iko	Crystal structure of the heterotrimeric Sec13-Nup145C-Nup84 nucleoporin complex
3j2t	An improved model of the human apoptosome
3j6x	3J6X
3j6y	3J6Y
3j77	3J77
3j78	3J78
3j7p	3J7P
3j7r	3J7R
3j80	3J80
3j81	3J81
3jag	3JAG
3jah	3JAH
3jai	3JAI
3jaj	3JAJ
3jam	3JAM
3jan	3JAN
3jap	3JAP
3jaq	3JAQ
3jb9	3JB9
3jbt	3JBT
3jcm	3JCM
3jcr	3JCR
3jct	3JCT
3jpx	EED: A Novel Histone Trimethyllysine Binder Within The EED-EZH2 Polycomb Complex
3jro	NUP84-NUP145C-SEC13 edge element of the NPC lattice
3jrp	SEC13 with NUP145C (AA109-179) insertion blade
3jzg	Structure of EED in complex with H3K27me3
3jzh	EED-H3K79me3
3jzn	Structure of EED in apo form
3k26	Complex structure of EED and trimethylated H3K4
3k27	Complex structure of EED and trimethylated H3K9
3krw	Human GRK2 in complex with Gbetgamma subunits and balanol (soak)
3krx	Human GRK2 in complex with Gbetgamma subunits and balanol (co-crystal)
3mkq	Crystal structure of yeast alpha/betaprime-COP subcomplex of the COPI vesicular coat
3mks	Crystal Structure of yeast Cdc4/Skp1 in complex with an allosteric inhibitor SCF-I2
3mmy	Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1
3mxx	Crystal structure of WDR5 mutant (S62A)
3mzk	Sec13/Sec16 complex, S.cerevisiae
3mzl	Sec13/Sec31 edge element, loop deletion mutant
3n0d	Crystal structure of WDR5 mutant (W330F)
3n0e	Crystal structure of WDR5 mutant (W330Y)
3odt	Crystal structure of WD40 beta propeller domain of Doa1
3ow8	Crystal Structure of the WD repeat-containing protein 61
3p4f	Structural and biochemical insights into MLL1 core complex assembly and regulation.
3psc	Bovine GRK2 in complex with Gbetagamma subunits
3psl	Fine-tuning the stimulation of MLL1 methyltransferase activity by a histone H3 based peptide mimetic
3pvu	Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD101)
3pvw	Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD103A)
3rfg	Crystal structure of the yeast RACK1 dimer in space group P63
3rfh	Crystal structure of the yeast RACK1 dimer in space group P21
3rse	Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex
3sfz	Crystal structure of full-length murine Apaf-1
3shf	Crystal structure of the R265S mutant of full-length murine Apaf-1
3smr	Crystal structure of human WD repeat domain 5 with compound
3sn6	Crystal structure of the beta2 adrenergic receptor-Gs protein complex
3ukr	Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
3uku	Structure of Arp2/3 complex with bound inhibitor CK-869
3ule	Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
3ur4	Crystal structure of human WD repeat domain 5 with compound
3uvk	Crystal structure of WDR5 in complex with the WDR5-interacting motif of MLL2
3uvl	Crystal structure of WDR5 in complex with the WDR5-interacting motif of MLL3
3uvm	Crystal structure of WDR5 in complex with the WDR5-interacting motif of MLL4
3uvn	Crystal structure of WDR5 in complex with the WDR5-interacting motif of SET1A
3uvo	Crystal structure of WDR5 in complex with the WDR5-interacting motif of SET1B
3uzs	Structure of the C13.28 RNA Aptamer Bound to the G Protein-Coupled Receptor Kinase 2-Heterotrimeric G Protein Beta 1 and Gamma 2 Subunit Complex
3v5w	Human G Protein-Coupled Receptor Kinase 2 in Complex with Soluble Gbetagamma Subunits and Paroxetine
3v7d	Crystal Structure of ScSkp1-ScCdc4-pSic1 peptide complex
3vl1	Crystal structure of yeast Rpn14
3vu4	Crystal structure of Kluyvelomyces marxianus Hsv2
3w15	Structure of peroxisomal targeting signal 2 (PTS2) of Saccharomyces cerevisiae 3-ketoacyl-CoA thiolase in complex with Pex7p and Pex21p
3zwl	Structure of eukaryotic translation initiation factor eIF3i complex with eIF3b C-terminus (655-700)
4a08	Structure of hsDDB1-drDDB2 bound to a 13 bp CPD-duplex (purine at D-1 position) at 3.0 A resolution (CPD 1)
4a09	Structure of hsDDB1-drDDB2 bound to a 15 bp CPD-duplex (purine at D-1 position) at 3.1 A resolution (CPD 2)
4a0a	Structure of hsDDB1-drDDB2 bound to a 16 bp CPD-duplex (pyrimidine at D-1 position) at 3.6 A resolution (CPD 3)
4a0b	Structure of hsDDB1-drDDB2 bound to a 16 bp CPD-duplex (pyrimidine at D-1 position) at 3.8 A resolution (CPD 4)
4a0k	STRUCTURE OF DDB1-DDB2-CUL4A-RBX1 BOUND TO A 12 BP ABASIC SITE CONTAINING DNA-DUPLEX
4a0l	Structure of DDB1-DDB2-CUL4B-RBX1 bound to a 12 bp abasic site containing DNA-duplex
4a11	Structure of the hsDDB1-hsCSA complex
4a7j	Symmetric Dimethylation of H3 Arginine 2 is a Novel Histone Mark that Supports Euchromatin Maintenance
4aez	Crystal Structure of Mitotic Checkpoint Complex
4aow	Crystal structure of the human Rack1 protein at a resolution of 2.45 angstrom
4av8	Kluyveromyces lactis Hsv2 complete loop 6CD
4av9	Kluyveromyces lactis Hsv2
4bh6	Insights into degron recognition by APC coactivators from the structure of an Acm1-Cdh1 complex
4bl0	Crystal structure of yeast Bub3-Bub1 bound to phospho-Spc105
4bts	4BTS
4buj	Crystal structure of the S. cerevisiae Ski2-3-8 complex
4bzj	The structure of the COPII coat assembled on membranes
4bzk	The structure of the COPII coat assembled on membranes
4ci8	Crystal structure of the tandem atypical beta-propeller domain of EML1
4cy1	Crystal structure of the KANSL1-WDR5 complex.
4cy2	Crystal structure of the KANSL1-WDR5-KANSL2 complex.
4cy3	Crystal structure of the NSL1-WDS complex.
4cy5	Crystal structure of the NSL1-WDS-NSL2 complex.
4czv	4CZV
4czx	4CZX
4czy	4CZY
4d0k	4D0K
4d5l	4D5L
4d61	4D61
4d6v	4D6V
4e54	Damaged DNA induced UV-damaged DNA-binding protein (UV-DDB) dimerization and its roles in chromatinized DNA repair
4e5z	Damaged DNA induced UV-damaged DNA-binding protein (UV-DDB) dimerization and its roles in chromatinized DNA repair
4erq	X-ray structure of WDR5-MLL2 Win motif peptide binary complex
4ery	X-ray structure of WDR5-MLL3 Win motif peptide binary complex
4erz	X-ray structure of WDR5-MLL4 Win motif peptide binary complex
4es0	X-ray structure of WDR5-SETd1b Win motif peptide binary complex
4esg	X-ray structure of WDR5-MLL1 Win motif peptide binary complex
4ewr	X-ray structure of WDR5-SETd1a Win motif peptide binary complex
4exv	Structure of Kluyveromyces lactis Hsv2p
4fhl	Nucleoporin Nup37 from Schizosaccharomyces pombe
4fhm	Nup37-Nup120(aa1-961) complex from Schizosaccharomyces pombe
4fhn	Nup37-Nup120 full-length complex from Schizosaccharomyces pombe
4g56	Crystal Structure of full length PRMT5/MEP50 complexes from Xenopus laevis
4gga	Structural Analysis of Human Cdc20 Supports Multi-site Degron Recognition by APC/C
4ggc	Structural Analysis of Human Cdc20 Supports Multi-site Degron Recognition by APC/C
4ggd	Structural analysis of human Cdc20 supports multisite degron recognition by APC/C.
4gm3	Crystal structure of human WD repeat domain 5 with compound MM-101
4gm8	Crystal structure of human WD repeat domain 5 with compound MM-102
4gm9	Crystal structure of human WD repeat domain 5 with compound MM-401
4gmb	Crystal structure of human WD repeat domain 5 with compound MM-402
4gq1	Nup37 of S. pombe
4gq2	S. pombe Nup120-Nup37 complex
4gqb	Crystal Structure of the human PRMT5:MEP50 Complex
4h5i	Crystal Structure of the Guanine Nucleotide Exchange Factor Sec12 (P1 form)
4h5j	Crystal Structure of the Guanine Nucleotide Exchange Factor Sec12 (P64 form)
4i79	Crystal structure of human NUP43
4ia9	Crystal structure of human WD REPEAT DOMAIN 5 in complex with 2-chloro-4-fluoro-3-methyl-N-[2-(4-methylpiperazin-1-yl)-5-nitrophenyl]benzamide
4j0w	Structure of U3-55K
4j0x	Structure of Rrp9
4j73	Crystal structure of beta'-COP/p25 complex
4j77	Crystal structure of beta'-COP/hWbp1 complex
4j78	Crystal structure of beta'-COP/Emp47p complex
4j79	Crystal structure of beta'-COP/PEDVspike complex
4j81	Crystal structure of beta'-COP/Insig-1 complex
4j82	Crystal structure of beta'-COP/Insig-2 complex
4j84	Crystal structure of beta'-COP/Scyl1 complex
4j86	Crystal structure of beta'-COP/yWbp1 complex
4j87	Crystal structure of alpha-COP
4j8b	Crystal structure of alpha-COP/Emp47p complex
4j8g	Crystal structure of alpha-COP/E19 complex
4jd2	Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
4jsn	structure of mTORdeltaN-mLST8 complex
4jsp	structure of mTORDeltaN-mLST8-ATPgammaS-Mg complex
4jsv	mTOR kinase structure, mechanism and regulation.
4jsx	structure of mTORDeltaN-mLST8-Torin2 complex
4jt5	mTORdeltaN-mLST8-pp242 complex
4jt6	structure of mTORDeltaN-mLST8-PI-103 complex
4jxm	Crystal structure of RRP9 WD40 repeats
4kfm	Crystal structure of the G protein-gated inward rectifier K+ channel GIRK2 (Kir3.2) in complex with the beta-gamma G protein subunits
4kzx	Rabbit 40S ribosomal subunit in complex with eIF1.
4kzy	Rabbit 40S ribosomal subunit in complex with eIF1 and eIF1A.
4kzz	Rabbit 40S ribosomal subunit in complex with mRNA, initiator tRNA and eIF1A
4l9o	Crystal Structure of the Sec13-Sec16 blade-inserted complex from Pichia pastoris
4lg8	Crystal structure of PRPF19 WD40 repeats
4lg9	Crystal structure of TBL1XR1 WD40 repeats
4mk0	Crystal structure of G protein-coupled receptor kinase 2 in complex with a a rationally designed paroxetine derivative
4n14	4N14
4nsx	Crystal Structure of the Utp21 tandem WD Domain
4o45	WDR5 in complex with influenza NS1 C-terminal tail
4o9d	Structure of Dos1 propeller
4owr	4OWR
4ozu	4OZU
4pby	4PBY
4pbz	4PBZ
4pc0	4PC0
4pnk	4PNK
4psw	4PSW
4psx	4PSX
4ql1	4QL1
4qqe	4QQE
4r7a	4R7A
4u1e	4U1E
4u3m	4U3M
4u3n	4U3N
4u3u	4U3U
4u4n	4U4N
4u4o	4U4O
4u4q	4U4Q
4u4r	4U4R
4u4u	4U4U
4u4y	4U4Y
4u4z	4U4Z
4u50	4U50
4u51	4U51
4u52	4U52
4u53	4U53
4u55	4U55
4u56	4U56
4u6f	4U6F
4u7a	4U7A
4uer	4UER
4ug0	4UG0
4ui9	4UI9
4ujc	4UJC
4ujd	4UJD
4uje	4UJE
4v16	4V16
4v3p	4V3P
4v5o	4V5O
4v5z	4V5Z
4v6i	4V6I
4v6w	4V6W
4v6x	4V6X
4v7e	4V7E
4v7f	4V7F
4v7h	4V7H
4v7r	4V7R
4v88	4V88
4v8m	4V8M
4v8y	4V8Y
4v8z	4V8Z
4v92	4V92
4wjs	4WJS
4wju	4WJU
4wjv	4WJV
4x3e	4X3E
4x60	4X60
4x61	4X61
4x63	4X63
4xei	4XEI
4xf2	4XF2
4xfv	4XFV
4xmm	4XMM
4xmn	4XMN
4xyh	4XYH
4xyi	4XYI
4y7r	4Y7R
4ycz	4YCZ
4yhc	4YHC
4yvd	4YVD
4zn4	4ZN4
4zov	4ZOV
4zox	4ZOX
4zoy	4ZOY
4zoz	4ZOZ
5a1u	5A1U
5a1v	5A1V
5a1w	5A1W
5a1x	5A1X
5a1y	5A1Y
5a2q	5A2Q
5a31	5A31
5a5u	5A5U
5a9q	5A9Q
5afu	5AFU
5aj0	5AJ0
5ams	5AMS
5c9z	5C9Z
5ch1	5CH1
5ch2	5CH2
5cvl	5CVL
5cvn	5CVN
5cvo	5CVO
5cxb	5CXB
5cxc	5CXC
5cyk	5CYK
5dat	5DAT
5dc3	5DC3
5dfz	5DFZ
5eal	5EAL
5eam	5EAM
5eap	5EAP
5ear	5EAR
5em2	5EM2
5emj	5EMJ
5emk	5EMK
5eml	5EML
5emm	5EMM
5fa5	5FA5
5fci	5FCI
5fcj	5FCJ
5fl8	5FL8
5flc	5FLC
5flx	5FLX
5fvm	5FVM
5fxy	5FXY
5g04	5G04
5gan	5GAN
5gap	5GAP
5gm6	5GM6
5gmk	5GMK
5gxh	5GXH
5gxi	5GXI
5h1j	5H1J
5h1k	5H1K
5h1l	5H1L
5h1m	5H1M
5he0	5HE0
5he1	5HE1
5he2	5HE2
5he3	5HE3
5hqg	5HQG
5hyn	5HYN
5i4l	5I4L
5ic7	5IC7
5igo	5IGO
5igq	5IGQ
5ij7	5IJ7
5ij8	5IJ8
5it7	5IT7
5it9	5IT9
5jcs	5JCS
5jpq	5JPQ
5juo	5JUO
5jup	5JUP
5jus	5JUS
5jut	5JUT
5juu	5JUU
5juy	5JUY
5k0y	5K0Y
5k19	5K19
5k1a	5K1A
5k1b	5K1B
5k1c	5K1C
5kc2	5KC2
5kdo	5KDO
5khr	5KHR
5khu	5KHU
5l8e	5L8E
5l8w	5L8W
5l9t	5L9T
5l9u	5L9U
5lcw	5LCW
5lj3	5LJ3
5lj5	5LJ5
5lqw	5LQW
5lyb	5LYB
5lzs	5LZS
5lzt	5LZT
5lzu	5LZU
5lzv	5LZV
5lzw	5LZW
5lzx	5LZX
5lzy	5LZY
5lzz	5LZZ
5sxm	5SXM
5tdh	5TDH
5tee	5TEE
5tef	5TEF
5tf2	5TF2
5tga	5TGA
5tha	5THA

Links (links to other resources describing this domain)

• PROSITE: WD_REPEATS
• PFAM: WD40
• INTERPRO: IPR001680