The domain within your query sequence starts at position 95 and ends at position 175; the E-value for the WGR domain shown below is 1.17e-35.
YDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKE IFQKKFLDKTKNNWEDRENFE
WGRProposed nucleic acid binding domain |
---|
SMART accession number: | SM00773 |
---|---|
Description: | This domain is named after its most conserved central motif. It is found in a variety of polyA polymerases as well as in molybdate metabolism regulators (e.g. in E.coli) and other proteins of unknown function. The domain is found in isolation in some proteins and is between 70 and 80 residues in length. It is proposed that it may be a nucleic acid binding domain. |
Interpro abstract (IPR008893): | This domain is named after the most conserved central motif of the domain. It is found in a variety of polyA polymerases as well as the Escherichia coli molybdate metabolism regulator P33345 and other proteins of unknown function.The domain is found in isolation in proteins such as Q9JN21 and is between 70 and 80 residues in length. |
Family alignment: |
There are 6953 WGR domains in 6872 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)