The domain within your query sequence starts at position 139 and ends at position 231; the E-value for the WSC domain shown below is 8.72e-40.

RGNYLGCFSEEGQERTLKGAVFYDLRKMTVSHCQDACAERSYVYAGLEAGAECYCGNRLP
ATRVSLKECNQECKGEKGSMCGAVRRLSVYSVG

WSC

present in yeast cell wall integrity and stress response component proteins
WSC
SMART accession number:SM00321
Description: Domain present in WSC proteins, polycystin and fungal exoglucanase
Interpro abstract (IPR002889):

The WSC domain is a putative carbohydrate binding domain. The domain contains up to eight conserved cysteine residues that may be involved in disulphide bridges. The Trichoderma harzianum beta-1,3 exoglucanase contains two copies of the WSC domain, while the yeast SLG1 protein contains only one.

Family alignment:
View or

There are 6536 WSC domains in 2069 proteins in SMART's nrdb database.

Click on the following links for more information.