The domain within your query sequence starts at position 1549 and ends at position 1654; the E-value for the ZU5 domain shown below is 1.1e-56.

VVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGE
TLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSS

ZU5

Domain present in ZO-1 and Unc5-like netrin receptors
ZU5
SMART accession number:SM00218
Description: Domain of unknown function.
Interpro abstract (IPR000906):

The ZU5 domain is a domain of 90-110 residues present in zona occludens 1 (ZO-1) protein, in unc5-like netrin receptors and in ankyrins. The ZU5 domain is named after the mouse tight junction protein ZO-1 and the C. elegans uncoordinated protein 5 (unc-5) and related Unc5-like netrin receptors. ZU5 domains are found in eukaryotic proteins that in most cases contain a C-terminal death domain. Other domains which can be found N-terminal to a ZU5 domain are ankyrin repeats; Ig-like and TSP1 repeats; PDZ, SH3 and guanylate kinase; or leucine-rich repeats (LRR) [ (PUBMED:9126742) (PUBMED:9126743) (PUBMED:14769797) (PUBMED:15073321) ]. The ZU5 domain can function as a spectrin-binding domain in ankyrins [ (PUBMED:15262991) ], and participates in induction of apoptosis and binding of melanoma-associated antigen D1 (MAGE-D1/NRAGE) in UNC5H1-3 [ (PUBMED:12598531) ].

Family alignment:
View or

There are 4021 ZU5 domains in 4021 proteins in SMART's nrdb database.

Click on the following links for more information.