The domain within your query sequence starts at position 402 and ends at position 432; the E-value for the c-clamp domain shown below is 5.29e-7.
PKKCRARFGLDQQNNWCGPCRCKYAKEVSGT
c-clamp |
---|
SMART accession number: | SM01366 |
---|---|
Description: | Sequence-specific DNA binding domain in TCFs. |
Family alignment: |
There are 2843 c-clamp domains in 2828 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)