The domain within your query sequence starts at position 536 and ends at position 566; the E-value for the c-clamp domain shown below is 1.55e-13.
GKKCRKVYGMENRDMWCTACRWKKACQRFID
c-clamp |
|---|
| SMART accession number: | SM01366 |
|---|---|
| Description: | Sequence-specific DNA binding domain in TCFs. |
| Family alignment: |
There are 2843 c-clamp domains in 2828 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)