The domain within your query sequence starts at position 280 and ends at position 398; the E-value for the cNMP domain shown below is 4.8e-13.

AFANMTMSVRRELCSVMVFEVVEQAGAVILEDGQELDSWYVILNGTVEISHPDGKIENLF
MGNSFGIVPTLDKQHMHGAVRTKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVM

cNMP

Cyclic nucleotide-monophosphate binding domain
cNMP
SMART accession number:SM00100
Description: Catabolite gene activator protein (CAP) is a prokaryotic homologue of eukaryotic cNMP-binding domains, present in ion channels, and cNMP-dependent kinases.
Interpro abstract (IPR000595):

Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [ (PUBMED:14638413) (PUBMED:10550204) (PUBMED:1710853) ]. The best studied of these proteins is the prokaryotic catabolite gene activator (also known as the cAMP receptor protein) (gene crp) where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure. There are six invariant amino acids in this domain, three of which are glycine residues that are thought to be essential for maintenance of the structural integrity of the beta-barrel. cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain. The cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain. The cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section. Vertebrate cyclic nucleotide-gated ion-channels also contain this domain. Two such cations channels have been fully characterised, one is found in rod cells where it plays a role in visual signal transduction.

Family alignment:
View or

There are 149838 cNMP domains in 136080 proteins in SMART's nrdb database.

Click on the following links for more information.