The domain within your query sequence starts at position 1494 and ends at position 1581; the E-value for the eIF5C domain shown below is 3.78e-33.

ARLLQKYLCDEQKELQALYALQALVVTLEQPANLLRMFFDALYDEDVVKEDAFYSWESSK
DPAEQQGKGVALKSVTAFFNWLREAEDE

eIF5C

Domain at the C-termini of GCD6, eIF-2B epsilon, eIF-4 gamma and eIF-5
eIF5C
SMART accession number:SM00515
Description: -
Interpro abstract (IPR003307):

Translation initiation is a sophisticated, well regulated and highly coordinated cellular process in eukaryotes, in which at least 11 eukayrotic initiation factors (eIFs) are included. The W2 domain (two invariant tryptophans) is a region of ~165 amino acids which is found in the C terminus of the following eIFs [ (PUBMED:8520487) (PUBMED:10958635) (PUBMED:14681227) (PUBMED:16616930) (PUBMED:16781736) ]:

  • Eukaryotic translation initiation factor 2B epsilon (eIF-2B-epsilon).
  • Eukaryotic translation initiation factor 4 gamma (eIF-4-gamma).
  • Eukaryotic translation initiation factor 5 (eIF-5), a GTPase-activating protein (GAP) specific for eIF2.

The W2 domain has a globular fold and is exclusively composed out of alpha- helices [ (PUBMED:14681227) (PUBMED:16616930) (PUBMED:16781736) ]. The structure can be divided into a structural C-terminal core onto which the two N-terminal helices are attached. The core contains two aromatic/acidic residue-rich regions (AA boxes), which are important for mediating protein-protein interactions.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 4417 eIF5C domains in 4416 proteins in SMART's nrdb database.

Click on the following links for more information.