The domain within your query sequence starts at position 232 and ends at position 264; the E-value for the tRNA_SAD domain shown below is 7.5e-5.

ATVYGCGMSVDLCRGPHLRHTGQIGALKLLTSY

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain
tRNA_SAD
SMART accession number:SM00863
Description: The catalytically active form of threonyl/alanyl tRNA synthetase is a dimer. Within the tRNA synthetase class II dimer, the bound tRNA interacts with both monomers making specific interactions with the catalytic domain, the C-terminal domain, and this SAD domain (the second additional domain). The second additional domain is comprised of a pair of perpendicularly orientated antiparallel beta sheets, of four and three strands, respectively, that surround a central alpha helix that forms the core of the domain.
Interpro abstract (IPR012947):

The catalytically active form of threonyl/alanyl tRNA synthetase is a dimer. Within the tRNA synthetase class II dimer, the bound tRNA interacts with both monomers making specific interactions with the catalytic domain, the C-terminal domain, and this SAD domain (the second additional domain). The second additional domain is comprised of a pair of perpendicularly orientated antiparallel beta sheets, of four and three strands, respectively, that surround a central alpha helix that forms the core of the domain [ (PUBMED:10319817) ].

GO process:tRNA aminoacylation (GO:0043039)
GO function:ATP binding (GO:0005524), aminoacyl-tRNA ligase activity (GO:0004812)
Family alignment:
View or

There are 57173 tRNA_SAD domains in 57163 proteins in SMART's nrdb database.

Click on the following links for more information.