The domain within your query sequence starts at position 52 and ends at position 164; the E-value for the zf-3CxxC domain shown below is 2.13e-52.

KTFARFHCPSCSRSWASGRVLIVFHMRWCEKKAKGWVKMRVFAQRCNQCPEPPFATPEVT
WDNISRILNNLLFQILKKCYKEGFKQMGEIPLLGNTSLEGPHDSSNCEACLLG

zf-3CxxC

Zinc-binding domain
zf-3CxxC
SMART accession number:SM01328
Description: This is a family with several pairs of CxxC motifs possibly representing a multiple zinc-binding region. Only one pair of cysteines is associated with a highly conserved histidine residue.
Interpro abstract (IPR027377):

This is a domain with several pairs of CxxC motifs, possibly representing a multiple zinc-binding region. Only one pair of cysteines is associated with a highly conserved histidine residue.

Family alignment:
View or

There are 2480 zf-3CxxC domains in 2474 proteins in SMART's nrdb database.

Click on the following links for more information.