The domain within your query sequence starts at position 181 and ends at position 234; the E-value for the ELM2 domain shown below is 1.14e-11.

IMVGSMFQAEIPVGVCRYKENEKVYENDDQLLWDPECLPEEKVVVFLKDASRRT

ELM2

ELM2
SMART accession number:SM01189
Description: The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex (PUBMED:10226007). The domain is usually found to the N terminus of a myb-like DNA binding domain SANT SM00717. ELM2 is also found associated with an ARID DNA binding domain SM01014 in Q84JT7. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.
Interpro abstract (IPR000949):

The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex [ (PUBMED:10226007) ]. The domain is usually found to the N terminus of a myb-like DNA binding domain and a GATA binding domain. ELM2, in some instances, is also found associated with the ARID DNA binding domain IPR001606 . This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.

Family alignment:
View or

There are 7103 ELM2 domains in 7092 proteins in SMART's nrdb database.

Click on the following links for more information.