The domain within your query sequence starts at position 153 and ends at position 243; the E-value for the FH domain shown below is 3.32e-61.

MVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDC
FKKVPRDEDDPGKGNYWTLDPNCEKMFDNGN

FH

FORKHEAD
FH
SMART accession number:SM00339
Description: FORKHEAD, also known as a "winged helix"
Interpro abstract (IPR001766):

The fork head domain is a conserved DNA-binding domain (also known as a "winged helix") of about 100 amino-acid residues.

Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [ (PUBMED:2566386) ]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [ (PUBMED:2566386) (PUBMED:8332212) (PUBMED:1356269) ].

The fork head domain binds B-DNA as a monomer [ (PUBMED:8332212) ], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [ (PUBMED:1356269) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:sequence-specific DNA binding (GO:0043565), DNA-binding transcription factor activity (GO:0003700)
Family alignment:
View or

There are 22315 FH domains in 22242 proteins in SMART's nrdb database.

Click on the following links for more information.