The domain within your query sequence starts at position 264 and ends at position 621; the E-value for the Frizzled domain shown below is 1.47e-219.

PFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVG
YLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQH
VRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAA
WLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFV
SLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATH
NCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWA

Frizzled

Frizzled/Smoothened family membrane region
Frizzled
SMART accession number:SM01330
Description: Frizzled is a family of G protein-coupled receptor proteins (PMID: 14977528) that serves as receptors in the Wnt signaling pathway and other signaling pathways. When activated, Frizzled leads to activation of Dishevelled in the cytosol.
Interpro abstract (IPR000539):

This domain is the membrane spanning region of frizzled and smoothened receptors. This membrane region is predicted to contain seven transmembrane alpha helices. Proteins related to Drosophila frizzled ( P18537 ) are receptors for Wnt (mediating the beta-catenin signalling pathway) [ (PUBMED:8717036) ], but also the planar cell polarity (PCP) pathway and the Wnt/calcium pathway. The predominantly alpha-helical Cys-rich ligand-binding region (CRD) of Frizzled is both necessary and sufficient for Wnt binding [ (PUBMED:15239825) ]. The smoothened receptor mediates hedgehog signalling [ (PUBMED:9811578) ].

GO process:cell surface receptor signaling pathway (GO:0007166)
GO component:membrane (GO:0016020)
Family alignment:
View or

There are 5099 Frizzled domains in 5097 proteins in SMART's nrdb database.

Click on the following links for more information.