The domain within your query sequence starts at position 14 and ends at position 97; the E-value for the MAGUK_N_PEST domain shown below is 1.5e-47.

KKYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAP
IIVNTDTLDTIPYVNGTEIEYEFE

MAGUK_N_PEST

Polyubiquitination (PEST) N-terminal domain of MAGUK
MAGUK_N_PEST
SMART accession number:SM01277
Description: The residues upstream of this domain are the probable palmitoylation sites, particularly two cysteines. The domain has a putative PEST site at the very start that seems to be responsible for poly-ubiquitination PMID:8755249. PEST domains are polypeptide sequences enriched in proline (P), glutamic acid (E), serine (S) and threonine (T) that target proteins for rapid destruction. The whole domain, in conjunction with a C-terminal domain of the longer protein, is necessary for dimerisation of the whole protein PMID:18215622.
Interpro abstract (IPR019590):

This domain can be found in Disks large homologue 1 (DLG1 or SAP97), a membrane-associated guanylate kinase protein (MAGUK) that serves as an important determinant of localization and organisation of ion channels into specific plasma membrane domains [ (PUBMED:18245566) ].

The residues upstream of this domain are the probable palmitoylation sites, particularly two cysteines. The domain has a putative PEST site at the very start that seems to be responsible for poly-ubiquitination [ (PUBMED:8755249) ]. PEST domains are polypeptide sequences enriched in proline (P), glutamic acid (E), serine (S) and threonine (T) that target proteins for rapid destruction. The whole domain, in conjunction with a C-terminal domain of the longer protein, is necessary for dimerisation of the whole protein [ (PUBMED:18215622) ].

Family alignment:
View or

There are 2836 MAGUK_N_PEST domains in 2831 proteins in SMART's nrdb database.

Click on the following links for more information.