The domain within your query sequence starts at position 75 and ends at position 282; the E-value for the NUC domain shown below is 3.37e-107.

All catalytic sites are present in this domain. Check the literature (PubMed 9257723 ) for details.

RESYVLSYDPRTRGALWVLEQLRPERLRGDGDRSACDFREDDSVHAYHRATNADYRGSGF
DRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQNAWNNLERYSRSLTRTYQNVYVCT
GPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRSYVMPNAPVDET
IPLERFLVPIESIERASGLLFVPNILAR

NUC

DNA/RNA non-specific endonuclease
NUC
SMART accession number:SM00477
Description: prokaryotic and eukaryotic double- and single-stranded DNA and RNA endonucleases also present in phosphodiesterases
Interpro abstract (IPR020821):

A family of bacterial and eukaryotic endonucleases EC 3.1.30 share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. A histidine has been shown [ (PUBMED:8078761) ] to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion.

GO function:nucleic acid binding (GO:0003676), metal ion binding (GO:0046872), hydrolase activity (GO:0016787)
Family alignment:
View or

There are 11868 NUC domains in 11849 proteins in SMART's nrdb database.

Click on the following links for more information.